(data stored in ACNUC7421 zone)

EMBL: CP001854.PE42

CP001854.PE42        Location/Qualifiers
FT   CDS_pept        complement(42616..43371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48478"
FT                   /db_xref="GOA:D3F3Z5"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Z5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48478.1"
FT                   /translation="MPFAEIVIEIGGERALDHGANRAGFVLFAAFLLSFAFIRMSARLM
FT                   RSPKVPWWPGSVTTGDLHIHHLVFGIVLLLVAGFASIAFQPDSPWLEATAAVFGIGAGL
FT                   TLDEFALWLHLDDVYWSDEGRQSVDAVLFAALLGGLVLTGTVPFGDGGGVVGIVTTGLL
FT                   VIALSALALLKGKYVLGAAGLLFPLLSLTGAIRLAKPGTPWARWRYPEGSRKLARAQQR
FT                   ADHHAARLERWQDRIGGAPDKPSPRKPPP"
     atgccgttcg cggagatcgt catcgagatc ggaggcgagc gggcgctcga ccacggcgcc        60
     aaccgcgccg gcttcgtcct cttcgcggcg ttcctgctct cgttcgcgtt catccgcatg       120
     agcgcgcgcc tgatgcgcag cccgaaggtc ccgtggtggc cgggcagcgt cacgaccggc       180
     gacctccaca tccaccacct cgtgttcggg atcgtgctgc tgctcgtcgc gggcttcgcc       240
     tcgatcgcgt tccagcccga cagcccgtgg ctggaggcga ccgcggcggt cttcgggatc       300
     ggcgccgggc tgacgctcga cgagttcgcg ctgtggctgc acctcgacga cgtctactgg       360
     tccgatgagg ggcgccagtc ggtcgacgcg gtgctgttcg ccgcgctgct cggcggcctc       420
     gtgctgaccg ggacggtgcc gttcggcgac ggcggcggcg tcgtcggcat cgtgacgacc       480
     ggcctgctcg tgatcgcgct gtccgcgctg gcgctgctga agggcaagta cgtgctcggc       540
     gcggccggcc tgctgttccc gctgctcagc ctgaccggcg cgatccggct cgcgaagccg       600
     ggcacgccgt gggcgcgctg gcgctacccg gagggcagcc gcaagctcgc gcgggcgcag       660
     cagcgcgccg accaccacgc cgcccggctg gagcgctggc aggaccgcat cggcggagcg       720
     ccggacaagc cgtcgccgcg caagccgcct ccctag                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page