(data stored in ACNUC7421 zone)

EMBL: CP001854.PE43

CP001854.PE43        Location/Qualifiers
FT   CDS_pept        complement(43450..44379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0043"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mxa:MXAN_3578 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48479"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Z6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB48479.1"
FT                   /translation="METTTKRPLEGRVALVAGATRGAGRGIAVQLGAAGATVYATGRST
FT                   RASRREGDRPETIEETAELIDAAGGTGVAVRADHLEPEQVRAVVARIEREQGRLDVLVN
FT                   DIWGGDLLFRWETPLWEQSLDDGLKMLRLAIETHAITSHAALPLLLREPGGLVVEMTDG
FT                   TAEYNAANYRVSYFYDLAKTATLRMAFAQAHELGPRGATAVALTPGWLRSEAMLDTFMG
FT                   VTEETWRDALERVPHFCISESPAFVGRAVAALAADPERARWNGASLSSGQLAQVYGFTD
FT                   LDGSRPDAWRYVVEVQDPGRPADATGYR"
     atggagacaa cgacgaagag accgctggag ggtcgcgtcg cgctcgtcgc cggcgcgacc        60
     cgcggtgccg gtcgcggcat cgccgtgcag ctcggcgccg ccggtgcgac ggtgtacgcg       120
     accggccgct cgacgcgcgc gagccgccgc gagggcgacc ggccggagac gatcgaggag       180
     accgcggagc tgatcgacgc ggcgggcggc accggcgtcg cggtgcgggc cgaccacctc       240
     gaacccgagc aggtgcgcgc ggtggtggcg cggatcgagc gcgaacaggg ccggctcgac       300
     gtgctcgtga acgacatctg gggcggcgac ctgctgttca gatgggagac gccgctgtgg       360
     gagcagtcgc tcgacgacgg cctgaagatg ctgcggctgg cgatcgagac gcacgcgatc       420
     acgagccacg cggcgctgcc gctgctgctg cgcgagcccg gcgggctcgt cgtcgagatg       480
     accgacggca ccgccgagta caacgccgcc aactaccgcg tctcgtactt ctacgacctc       540
     gccaagaccg cgacgctgcg gatggccttc gcccaggcgc acgagctggg ccctcgcggc       600
     gcgaccgcgg tcgcgctgac gcccggctgg ctgcgctcgg aggcgatgct cgacacgttc       660
     atgggcgtga cggaggagac gtggcgcgac gcgctggagc gcgtgccgca cttctgcatc       720
     tcggagtcgc cggcgttcgt cggccgcgcc gtcgccgcac tcgccgccga ccccgagcgc       780
     gcgagatgga acggcgcctc gctctccagc ggccagctcg cgcaggtcta cggcttcacc       840
     gacctcgacg gctcccgccc cgacgcctgg cgctacgtcg tcgaggtcca ggatcccggc       900
     agaccggccg acgccaccgg ctaccgctga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page