(data stored in ACNUC7421 zone)

EMBL: CP001854.PE44

CP001854.PE44        Location/Qualifiers
FT   CDS_pept        44435..45391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0044"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein; KEGG:
FT                   bbt:BBta_6686 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48480"
FT                   /db_xref="GOA:D3F3Z7"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Z7"
FT                   /inference="protein motif:PFAM:PF08279"
FT                   /protein_id="ADB48480.1"
FT                   /translation="MRASRLVTLVLLLQARGPWTADELAERLEVSVRTVHRDVEALRAS
FT                   GVPIRGERGPAGGYRLPGGYRTRLTGLTPDEAEALFLAAPADALGLGGFLADAQLKLLA
FT                   ALPPQLRDRADRAAQLFHVDHRSWFGPDEQPPALGAIAGALWHGRRLRLVHRGRERVVD
FT                   PLGLVLKGPSWYLIGATERGERTFRVGRVERAVELEQEARRPPQFDLVAHWDAWSRAFE
FT                   DGLPYIAARVRVAPHKLGELRRVVDSRRRDLLPRHADGDEWLELEVWFERIEHAEGGLL
FT                   GLGAHVEVLAPPELRTRIEAHVATLARRYGVEHPSSS"
     atgcgcgcca gccgactcgt cacgctcgtg ctgctgctgc aggcacgcgg cccgtggact        60
     gctgatgagc tggccgagcg gctcgaggtc tccgtccgca ccgtccatcg tgacgtcgag       120
     gcgctgcgtg cgagcggcgt gccgatccgc ggcgagcgcg gcccggccgg cggttaccgg       180
     ctccccggcg gctaccgaac ccgcctcacc gggctcaccc ccgatgaggc ggaggcgctg       240
     ttcctggccg cgccggccga cgcgctcggg ctcggcggct tcctcgctga cgcgcagctg       300
     aagctgctcg ccgcgcttcc gccgcagctg cgcgaccgcg ccgaccgcgc cgcgcagctg       360
     ttccacgtcg accaccgcag ctggttcggt cccgacgagc agccgcccgc gctcggggcg       420
     atcgccggtg cgctgtggca cggtcgccgg ctgcggctcg tccatcgcgg ccgcgagcgc       480
     gtcgtcgacc cgctcgggct cgtgctgaag gggccgagct ggtacctgat cggggcgacc       540
     gagcgcggcg agcggacgtt ccgcgtcggt cgcgtcgaac gcgcggtcga gctggagcag       600
     gaggcgcgcc ggccgccgca gttcgacctc gtcgcgcact gggacgcctg gtcgcgcgcg       660
     ttcgaggacg ggctgccgta catagcggcg cgggtgcggg tcgcgccgca caagctcggc       720
     gagctgcgcc gggtcgtcga ctcgcgccgc cgcgatctgt tgccgcggca cgcggacggc       780
     gacgagtggc tggagctgga ggtgtggttc gagcggatcg agcacgccga aggcgggctg       840
     ctcgggctcg gcgcgcacgt cgaggtgctc gcgccgcccg agctgcgcac gcggatcgag       900
     gcgcacgtcg ccacgctcgc gcggcgctac ggcgtcgaac atccgtccag cagttga          957
//

If you have problems or comments...

PBIL Back to PBIL home page