(data stored in ACNUC7421 zone)

EMBL: CP001854.PE46

CP001854.PE46        Location/Qualifiers
FT   CDS_pept        45867..46601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0046"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   cja:CJA_2884 lytic murein transglycosylase, putative,
FT                   lmt23D"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48482"
FT                   /db_xref="GOA:D3F3Z9"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D3F3Z9"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ADB48482.1"
FT                   /translation="MSVAAVEGAAAPGTGAQAAIARIAELQTLVARAHGVPPVAAASAP
FT                   ATSFSSALAGAGVGQAIANSAAAGAPVTQPLPGATGAGSGLGGTPSPFDGLILAAAQKH
FT                   GLDPALLKGLIRAESNFDPTASSPAGAAGLVQLMPGTAASLGVTDRLDPAQSIDGGARY
FT                   LRQQLDAFGGDVTKALAAYNAGPGAVQRYNGVPPYAETQAYVQKVQAYADEYRVAPVAA
FT                   ALPAPTTLPTTAIPTTGSGSIT"
     gtgagcgtcg ccgccgtcga aggcgcggcc gcccctggca ccggcgcgca ggccgcgatc        60
     gcccgcatcg ccgagctgca gacgctcgtc gcgcgcgccc acggcgtgcc gccggtcgcc       120
     gcggcctccg cgcctgccac cagcttttcc tccgcgctcg cgggcgcggg cgtcggccaa       180
     gcgattgcaa actctgctgc agccggcgct cccgtcacgc aaccgctgcc cggcgccacc       240
     ggcgccggca gcgggctcgg aggaacgccg agcccgttcg acggcctgat cctcgccgcg       300
     gcgcagaagc acggcctcga ccccgcgctg ctgaagggcc tgatccgcgc cgagtcgaac       360
     ttcgacccga ccgcgtccag ccccgcgggc gccgccggcc tcgtccagct gatgcccggc       420
     acggccgcct cgctcggcgt gaccgaccgc ctcgacccgg cccagtcgat cgacggcggc       480
     gcgagatacc tgcgccagca gctcgacgcc ttcggcggcg acgtgacgaa ggcgctcgcc       540
     gcctacaacg ccggccccgg cgcagtccag cgctacaacg gcgttccgcc gtacgcggag       600
     acgcaggcgt acgtgcagaa ggtccaggcg tacgccgacg agtaccgcgt cgcgccggtc       660
     gccgccgcgc tgccagcccc cacgaccctt cccacgacag caatcccaac cacaggatcg       720
     ggatcgatca catga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page