(data stored in ACNUC7421 zone)

EMBL: CP001854.PE47

CP001854.PE47        Location/Qualifiers
FT   CDS_pept        46598..48046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0047"
FT                   /product="flagellar hook-length control protein"
FT                   /note="PFAM: flagellar hook-length control protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48483"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:D3F400"
FT                   /inference="protein motif:PFAM:PF02120"
FT                   /protein_id="ADB48483.1"
FT                   /translation="MSILIPPAPPPPAAAGPPKPGGRSAPPDGDPFASVLDQQARTATA
FT                   EGLAKQQEANDAKTVSGRDARPADGSPQQVGTDDVQPGAEGTDPAALAAALNGVLGVAT
FT                   TPATANAAVASAAAPPLPAAAAAAATTTAPVAAQVVPAATVDAPVAAPATAAPATPAPA
FT                   PAVPQPPSQPVVTTAPATAAATAPADVAPLATAVPAAAAVDAPESAPVQQPAAAAPSAA
FT                   AATAPAEQAGSGTTGGQTGNGATGDQRGAGQPAPTPGPAAVPGGDPAAAPQQPAEPAAA
FT                   STAAPNGGAASAPQPAAAASPSSAPIAPAAGQQLAAAHEASATGAATTRGAVTLEHAVE
FT                   TVRLAMRAGAERGVTHARISLSPQELGGIEIHLRHTADGIVAKVIADSAGAAQLLQQSG
FT                   GDLRRQLEQQGLNLLRLDIGASGEQAAHAGGQRGLGDPGSGGSSAGGPRTAGPDDAVLT
FT                   VERDAVPRGTTLALPNGALVDVLA"
     atgagcatcc tcatcccgcc ggcgccaccg ccgccggccg cagcggggcc gccgaaaccc        60
     ggcggccgat ccgcaccgcc ggacggagat ccgttcgcat cggtgctcga ccaacaggcc       120
     cggaccgcca ctgcggaagg cctcgcgaag cagcaggaag cgaacgacgc gaagaccgtg       180
     agcgggcggg atgcacgtcc cgccgacggt tcgccgcagc aggtgggcac ggatgatgtg       240
     cagccaggcg cggaggggac ggatcccgcc gcgctggccg ctgcgctgaa cggcgtgctc       300
     ggcgtcgcga cgacgccggc gaccgcgaac gcggccgtcg catccgccgc cgcgccgccg       360
     ctccccgccg ctgctgccgc cgccgcgacg acgaccgcgc cggtcgcggc ccaggtcgtg       420
     ccggccgcca cggtcgacgc gcctgtcgcc gcacccgcga ccgcggcccc ggcgacgccc       480
     gcaccggcac ccgccgtgcc gcagccgccg tcacagcccg tcgtcacgac cgcgccggcg       540
     accgccgccg cgaccgcgcc ggccgacgtc gcgccgctcg ccaccgccgt gccggccgcc       600
     gccgcggtcg acgcgccgga gagcgcgccc gtccagcagc cggccgcggc cgcgccgtcg       660
     gccgccgccg cgaccgcgcc ggccgagcag gccggcagcg gaacgaccgg cgggcagacc       720
     ggcaacggtg cgaccggcga ccagcgcggc gccggccagc cggcgccgac gcccggaccc       780
     gccgccgtcc cgggcggcga ccccgccgcc gcgccgcagc agccggccga gccggctgcg       840
     gcgtcgacgg ccgcgccgaa cggcggcgcc gcatccgcgc cgcagcccgc tgccgccgcg       900
     agcccgtcct ccgcgccgat cgcgcccgcg gcgggccagc agctcgccgc cgcgcacgag       960
     gcgagcgcga ccggcgccgc cacgacgcgc ggcgcggtca cgctcgagca tgccgtcgag      1020
     accgtgcggc tggcgatgcg cgccggcgcc gagcgcggcg tcacgcacgc tcgcatcagc      1080
     ctcagcccgc aggagctcgg cgggatcgag atccacctcc gtcacaccgc cgacgggatc      1140
     gtcgcgaagg tgatcgccga ctccgccggc gccgcgcagc tgctgcagca gtccggcggc      1200
     gacctgcgcc gtcagctcga gcagcagggg ctcaacctgc tgcggctcga catcggcgcc      1260
     tccggcgagc aggccgctca cgccggcggc cagcgcggtc tcggcgatcc gggcagcggc      1320
     ggcagctccg ccggcggccc gcggaccgcc gggcccgacg acgcggtcct gaccgtcgag      1380
     cgcgacgccg tcccgcgcgg cacgacgctc gcccttccca acggcgccct cgtcgacgtc      1440
     ctcgcctga                                                              1449
//

If you have problems or comments...

PBIL Back to PBIL home page