(data stored in ACNUC7421 zone)

EMBL: CP001854.PE48

CP001854.PE48        Location/Qualifiers
FT   CDS_pept        48062..48520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0048"
FT                   /product="flagellar hook capping protein"
FT                   /note="PFAM: flagellar hook capping protein; KEGG:
FT                   sat:SYN_02840 flagellar hook capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48484"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="UniProtKB/TrEMBL:D3F401"
FT                   /inference="protein motif:PFAM:PF03963"
FT                   /protein_id="ADB48484.1"
FT                   /translation="MPVDPTNPVNNAPATYDNSTRRESFLGKDDFLKLLIGQMQNQDPL
FT                   NPTDGAEYMGQMTQFSILEQITNLGQTTQAAASNDYDAQAIRLIGQTVSYLARVNEDGR
FT                   SVLRSFTGRVESVTFTSSGPQLTIDGRTGILPVSLTKVGTDTAARGDE"
     atgcccgtag atcccaccaa ccccgtcaac aacgcgccgg cgacgtacga caacagcacg        60
     agaagagagt cgttcctcgg caaggacgac ttcctcaagc tgctgatcgg ccagatgcag       120
     aaccaggatc cgctcaaccc caccgacggg gcggagtaca tgggccagat gacccagttc       180
     tcgatcctcg agcagatcac caacctcggc cagacgaccc aggccgcggc ctccaacgac       240
     tacgacgcgc aagcgatcag actgatcggc cagaccgtgt cgtacctcgc gagagtcaac       300
     gaggacggca gatcggtgct gagaagcttc accggcagag tcgagagcgt caccttcacc       360
     agcagcggac cgcagctgac gatcgacggc agaacgggca tcctccccgt ctcgctgacg       420
     aaggtcggca ccgacaccgc cgcgagaggg gacgagtga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page