(data stored in ACNUC7421 zone)

EMBL: CP001854.PE49

CP001854.PE49        Location/Qualifiers
FT   CDS_pept        48517..48909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0049"
FT                   /product="flagellar operon protein"
FT                   /note="TIGRFAM: flagellar operon protein; KEGG:
FT                   gme:Gmet_3104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48485"
FT                   /db_xref="InterPro:IPR013367"
FT                   /db_xref="UniProtKB/TrEMBL:D3F402"
FT                   /inference="protein motif:TFAM:TIGR02530"
FT                   /protein_id="ADB48485.1"
FT                   /translation="MSLNVPNAALVPPGVAPVAQPAPGQATRRDAPIQGPSFSDVLRSR
FT                   TQGVEFSRHALQRLERRGIELGEQTLARLTDGVDRAAGKGSRESVVFVDGTAFVVSVRN
FT                   RTVITAVDPEHMREHVFTNIDSAVIA"
     gtgagcctga acgtccccaa cgccgcgctc gtcccgcccg gcgtcgcacc ggtcgcgcag        60
     cctgcgcccg gccaagcgac gcgccgggac gcgccgatcc agggcccgtc gttctccgac       120
     gtgctgcgca gcagaacgca gggcgtggag ttctcgcgcc acgcgctgca gcggctggag       180
     cggcgcggca tcgagctggg cgagcagacg ctcgcgcggc tcaccgacgg cgtcgaccgt       240
     gcggcgggca agggctcgcg cgagtcggtc gtcttcgtcg acgggacggc gttcgtcgtc       300
     tcggtcagaa accgcaccgt catcacggcg gtcgaccccg agcacatgcg cgagcacgtg       360
     ttcacgaaca tcgacagcgc cgtcatcgca tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page