(data stored in ACNUC7421 zone)

EMBL: CP001854.PE5

CP001854.PE5         Location/Qualifiers
FT   CDS_pept        4289..6715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: bba:Bd0004 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA topoisomerase type IIA subunit
FT                   B region 2 domain protein; DNA gyrase subunit B domain
FT                   protein; TOPRIM domain protein; ATP-binding region ATPase
FT                   domain protein; SMART: DNA topoisomerase II; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48441"
FT                   /db_xref="GOA:D3EYQ8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYQ8"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADB48441.1"
FT                   /translation="MATDKPAADKPTPSPSYDAQDITVLEGLEAVRKRPGMYIGSTGIR
FT                   GLHHLVYEVVDNSVDEALAGHASAVDVTIHPDNSITVVDNGRGIPVAMMEKEGKPAVEV
FT                   VLTVLHAGGKFGDGGGYKVSGGLHGVGVSVVNALSEQLRVEIFRDGFAWSQDYVRGAPQ
FT                   GQLERGEATSETGTTITFLPDDEIMESLDFDFTTLEERLRETAFLTRGLRISLTDERGE
FT                   RRHVEFQYDGGIQDFVAYLNENKDPVQRKIVYFSSESDEGAVEVAMQWNSSYQESVFSF
FT                   ANNINTHEGGSHLSGFRSALTRTINKYAREKGFLKERDANLAGEDVREGLTAVISAKLA
FT                   EPQFEGQTKTKLGNPGMQGFTESIVNKGLDEFLEENPQDARSVILKAVQAAQARSAARK
FT                   ARDLTRRKSALENSRLPGKLADCSVKDPALSEIFIVEGDSAGGSAKQGRDRSTQAILPL
FT                   RGKILNVERARIDKVLGNNEVQALITAIGTGVRDDFDLEKARYHKIILMTDADVDGAHI
FT                   RTLVLTLLFREMMPLIDAGFIYIAKPPLYKLKQGKNERYIEKDSELEEMLLSDKLERFS
FT                   IFDRTGAETRLTEARWKRFTRLLKQYGGWASALRALSSHDVVDFLHESGILEANVTDEG
FT                   ALARLLRQPEADGAAFSVELVGEDEVELTVRSIERKTGHARTRHVRRAMLQANEYRQLA
FT                   RVHDQLVQAVGTPPFDIRLGDHRETAVSFDELRSRVMDMAGRGVEINRFKGLGEMNAEQ
FT                   LRETTMDPATRTLARVTMEDAAAAERVFSMLMGDQVEPRRNFIEENASLVTNLDV"
     ttggccaccg acaagcccgc ggctgacaag ccgaccccct cgcccagcta cgacgcacag        60
     gacatcaccg tcctcgaagg tctcgaggcg gtccgcaagc gtcccggcat gtacatcggc       120
     tcgaccggca tccgcggtct gcatcacctc gtctacgagg tcgtcgacaa ctcggtcgac       180
     gaggccctcg ccggccatgc gagcgcggtc gacgtcacga tccacccgga caactcgatc       240
     acggtcgtcg acaacggccg cgggataccg gtcgcgatga tggagaagga gggcaagccg       300
     gccgtcgagg tcgtgctgac cgtcctgcac gccggcggca agttcggcga cggcggcgga       360
     tacaaggtct ccggcggtct ccacggcgtc ggcgtatcgg tcgtcaacgc gctctccgag       420
     cagctcagag tcgagatctt ccgcgacggc ttcgcgtggt cgcaggacta cgtccgcggc       480
     gcgccgcagg gtcagctcga gagaggcgag gcgacgagcg agaccggcac gacgatcacg       540
     ttcctgcccg acgacgagat catggagtcg ctcgacttcg acttcacgac gctcgaagag       600
     cggctgcgcg agacggcgtt cctgacgaga ggtctgagaa tctcgctgac cgacgagcgc       660
     ggcgagagaa gacacgtcga gttccagtac gacggcggca tccaggattt cgtcgcgtac       720
     ctgaacgaga acaaggaccc tgtccagaga aagatcgtct acttctccag cgagagcgac       780
     gagggtgcgg tcgaggtcgc gatgcagtgg aactcctcct accaggagtc cgtcttctcg       840
     ttcgcgaaca acatcaacac gcacgagggc ggctcgcacc tctccggctt ccgctcggcg       900
     ctcacgcgca cgatcaacaa gtacgcgcgc gagaagggct tcctcaagga gagagacgcc       960
     aacctcgccg gcgaggacgt gcgcgaaggc ctgacggcgg tcatctccgc caagctggcc      1020
     gagccccagt tcgagggcca gacgaagacg aagctcggta acccgggcat gcagggcttc      1080
     accgagtcga tcgtcaacaa gggcctcgac gagttcctcg aggagaaccc gcaggacgcg      1140
     cgctcggtga tcctcaaggc ggtccaggcc gcgcaggcgc gctccgccgc gcgcaaggcg      1200
     cgcgacctga cgcggcgcaa gtccgcgctc gagaactcgc gcctgccggg caagctcgcc      1260
     gactgctcgg tgaaggaccc ggcgctgtcg gagatcttca tcgtcgaggg cgactccgcc      1320
     ggcggctccg cgaagcaggg ccgcgaccgt tcgacgcagg cgatcctgcc gctgcgcggc      1380
     aagatcctca acgtcgagcg cgcccgcatc gacaaggtgc tcggcaacaa cgaggtccag      1440
     gcgctgatca ccgcgatcgg caccggcgtg cgcgacgact tcgacctcga gaaggcgcgc      1500
     taccacaaga tcatcctgat gacggacgcc gacgtcgacg gcgcgcacat ccgcacgctc      1560
     gtgctgacgc tgctgttccg cgagatgatg ccgctgatcg acgccggctt catctacatc      1620
     gccaagccgc cgctctacaa gctcaagcag ggcaagaacg agcgctacat cgagaaggac      1680
     tccgagctgg aggagatgct gctgtcggac aagctggaga gattcagcat cttcgaccgc      1740
     acgggcgcgg agacgaggct gacggaggcg cgctggaagc gcttcacgcg gctgctgaag      1800
     cagtacggcg gctgggcgtc ggcgctgcgc gcgctgtcga gccacgacgt cgtcgacttc      1860
     ctccacgagt ccgggatcct cgaggcgaat gtgaccgacg agggcgcact cgcaaggctg      1920
     ctccggcagc ctgaggcgga tggcgcggcc ttcagcgtcg agctggtggg cgaggacgag      1980
     gtcgagctga cggtgcgctc gatcgagcgc aagaccggcc acgcccgcac ccgccacgtg      2040
     cgccgcgcga tgctgcaggc gaacgagtac cgccagctcg cgcgcgttca cgaccagctg      2100
     gtgcaggcgg tcggcacgcc gccgttcgac atccgcctcg gcgatcaccg cgagaccgca      2160
     gtctcgttcg atgagctgcg ctcgagagtc atggacatgg ccgggcgggg cgtcgagatc      2220
     aaccgcttca aggggctcgg ggagatgaac gccgagcagc tgcgcgagac gaccatggac      2280
     cccgcgaccc gcacgctcgc ccgcgtgacg atggaggacg ccgccgccgc cgagcgcgtc      2340
     ttctcgatgc tgatgggcga ccaggtggag ccgcggcgca acttcatcga ggagaacgca      2400
     agcctcgtga ccaacctgga tgtgtag                                          2427
//

If you have problems or comments...

PBIL Back to PBIL home page