(data stored in ACNUC7421 zone)

EMBL: CP001854.PE50

CP001854.PE50        Location/Qualifiers
FT   CDS_pept        48971..49852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0050"
FT                   /product="fagellar hook-basal body protein"
FT                   /note="TIGRFAM: fagellar hook-basal body protein; PFAM:
FT                   protein of unknown function DUF1078 domain protein;
FT                   flagellar basal body rod protein; KEGG: gme:Gmet_0431
FT                   flagellar basal body rod protein FlgG"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48486"
FT                   /db_xref="GOA:D3F403"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:D3F403"
FT                   /inference="protein motif:TFAM:TIGR03506"
FT                   /protein_id="ADB48486.1"
FT                   /translation="MMRGMFSAISGLKVNQTMLDVTANDLANVNTVAYKSSRTTFQDSL
FT                   AQLQRGAAGPGNGTGGSNALQIGLGVKLGSVDNIMTEGAPQTTGSPLDVYIEGSGWFRV
FT                   ANGTPPAVPTAFQWTRAGNFTTNSQGHLITSTGQYVVGRGATATPDGRGGFTYAPNATD
FT                   SYIQIPPGSTDVSISPDGGVSYVDRNRASPTFERRVTAGYIALGKFANEAGLQRNGGST
FT                   WSESAASGAATVDTPGVGGNGRTLAGMLEMSNVDLATQFTTMITAQRGFQANSRVISTS
FT                   DEMLQDLVNLKR"
     atgatgcgtg gcatgttctc cgcgatcagc ggactgaagg tcaaccagac gatgctcgac        60
     gtgaccgcga acgacctcgc gaacgtcaac accgtcgcgt acaagtcctc gcgcacgacg       120
     ttccaggact cgctcgccca gctccagcgc ggcgcggccg gaccgggcaa cggcaccggc       180
     ggctccaacg cgctccagat cggcctcggc gtcaagctcg gctcggtcga caacatcatg       240
     accgagggcg ctccgcagac gaccggctcg ccgctcgacg tctacatcga gggctccggc       300
     tggttccgcg tcgccaacgg cacgccgccg gcggtcccga cggcgttcca gtggacccgc       360
     gccggcaact tcacgaccaa ctcgcagggc cacctgatca cgagcaccgg tcagtacgtc       420
     gtcggccgcg gcgcgaccgc gacgccggac ggcagaggcg gcttcaccta cgcgccgaac       480
     gcgaccgact cctacatcca gatcccgccc ggctcgaccg atgtctcgat ctcgcccgac       540
     ggaggcgtct cctacgtcga tcgcaacaga gcgtcgccga cgttcgagag acgcgtcacc       600
     gccggctaca tcgcgctcgg caagttcgcc aacgaggcgg gcctgcagcg caacggcggc       660
     tcgacgtgga gcgagtcggc ggcgtccggc gcggcgaccg tcgacacgcc cggcgtcggc       720
     ggcaacggca gaacgctcgc cggcatgctc gagatgagca acgtcgacct cgccacccag       780
     ttcacgacca tgatcactgc gcagcgcggc ttccaggcca actcccgcgt catctcgact       840
     tcggacgaga tgctgcagga cctggtgaac ctcaagcgct ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page