(data stored in ACNUC7421 zone)

EMBL: CP001854.PE52

CP001854.PE52        Location/Qualifiers
FT   CDS_pept        50306..51103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0052"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   dde:Dde_3589 chemotaxis protein MotA"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48488"
FT                   /db_xref="GOA:D3F405"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:D3F405"
FT                   /inference="protein motif:PFAM:PF01618"
FT                   /protein_id="ADB48488.1"
FT                   /translation="MKASTAIGLVGGLLAILLTGMLEGTSPATFINIPAIIIVLVGTFM
FT                   ATMASVGIDQMKRIPTLYKITFSPQEQDLRARVDLLVGIAEQARREGLLALDAQLGDID
FT                   DEFTRKGLQLVVDGTDPDLVREILEAEIDGMVARHAIGANTFEKAGGYAPTLGILGAVM
FT                   GLISVLGNLSDPDSLGPAISVAFIATLYGVGGANIVFLPICSRLKALSEEEVELRTLTL
FT                   DGILAVQAGDNPRVVADKLSSYVPPSERATADDDNVAPLREAA"
     atgaaggcat caaccgcaat cggactcgtc ggcggcctcc tcgccatcct cctgacgggg        60
     atgctcgagg gcacctcgcc ggcgacgttc atcaacatcc ccgcgatcat catcgtgctc       120
     gtcggcacct tcatggcgac gatggccagc gtcggcatcg accagatgaa gcggatcccg       180
     acgctgtaca agatcacgtt cagcccgcag gagcaggatc tgcgcgcgcg cgtcgacctg       240
     ctcgtcggca tcgccgagca ggcgcgccgc gagggcctgc tcgcgctcga cgcgcagctc       300
     ggcgacatcg acgacgagtt cacccgcaag ggcctgcagc tggtcgtcga cggcaccgac       360
     cccgatctcg tgcgcgagat cctcgaagcc gagatcgacg gcatggtcgc gcgccacgcg       420
     atcggcgcca acacgttcga gaaggccggc ggctacgccc cgacgctcgg catcctcggc       480
     gccgtcatgg gcctcatctc ggtgctcggc aacctctccg accccgactc gctcggcccc       540
     gcgatctcgg tcgccttcat cgccacgctg tacggcgtcg gcggcgccaa catcgtcttc       600
     ctgccgatct gctcgcgcct gaaggcgctc tccgaggaag aggtcgagct gcgcacgctg       660
     acgctcgacg gcatcctcgc ggtgcaggcc ggcgacaacc cgcgcgtcgt cgccgacaag       720
     ctctcctcgt acgtcccgcc gtccgagcgc gcgacggccg acgacgacaa cgtcgcgccg       780
     ctccgagagg ctgcctga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page