(data stored in ACNUC7421 zone)

EMBL: CP001854.PE53

CP001854.PE53        Location/Qualifiers
FT   CDS_pept        51103..51975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0053"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: ppd:Ppro_3470
FT                   OmpA/MotB domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48489"
FT                   /db_xref="GOA:D3F406"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D3F406"
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /protein_id="ADB48489.1"
FT                   /translation="MSARNRRGGRRRRGGGGHHGPDERWLITYADMLTLLLALFIVLYS
FT                   ISSLNTSKFEEMKTSLRDAFSGKIISGGEGIIETGVSATRDTPTSIVPNITPPRVQIAN
FT                   PRDSTAAAALAARIEDNEFRRIKAQIDAYARTHGLRDQVEAVVARRGLVVRLLTDQVLF
FT                   DSGFADLKSEGMPLLTHVGNLLVIDRIHPILVEGHTDDVPISTSRFESNWELSTARATE
FT                   VVRYLIDRGVPTRRFGASGYADLHPLGSNGTDRGRARNRRVEVVLQRLHLTSSQTTDAA
FT                   PDPQEGLNP"
     atgtccgccc gcaaccgccg cggcggtcgc cgccgccgcg gcgggggcgg gcaccacggg        60
     cccgacgagc gctggctgat cacctacgcc gacatgctca cgctgctgtt ggcgctgttc       120
     atcgtcctct actcgatctc gtcgttgaac acgtcgaagt tcgaggagat gaagacgtcg       180
     ctgcgcgacg ccttctcggg caagatcatc agcggcggcg aggggatcat cgagaccggc       240
     gtctcggcga cgagagacac gccgacgtcg atcgtcccca acatcacgcc gccgagagtg       300
     cagatcgcga acccgagaga cagcaccgcg gccgcggcgc tcgccgcccg catcgaggac       360
     aacgagttca gaagaatcaa ggcgcagatc gacgcctacg cgcgcaccca cggcctcaga       420
     gaccaggtcg aggccgtcgt cgcgcggcgc gggctggtcg tccggctgct gaccgaccag       480
     gtcctgttcg actccggctt cgccgacctc aagagcgagg gcatgccgct gctcacgcac       540
     gtcggcaacc tgctcgtgat cgacagaatc cacccgatcc tcgtcgaggg ccacaccgac       600
     gacgtcccga tcagcacgtc gcgcttcgag tccaactggg agctgtcgac ggcgcgtgcg       660
     acggaggtcg tccgctacct catagatcgc ggcgtcccga cgagacgctt cggcgcctcc       720
     ggctacgccg acctccaccc tctcggctcc aacggcaccg accgcggacg cgcgcgcaat       780
     cgccgcgtcg aggtcgtgct ccagcggctg cacctgacca gctcgcaaac caccgatgca       840
     gcgccagatc ctcaggaagg cctgaaccca tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page