(data stored in ACNUC7421 zone)

EMBL: CP001854.PE54

CP001854.PE54        Location/Qualifiers
FT   CDS_pept        51972..52415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0054"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="PFAM: flagellar basal body-associated protein FliL"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48490"
FT                   /db_xref="GOA:D3F407"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:D3F407"
FT                   /inference="protein motif:PFAM:PF03748"
FT                   /protein_id="ADB48490.1"
FT                   /translation="MRKNVVVLVLVALIAGAGAAYTFAKPKKEVRHKIDGAVYVLPKEF
FT                   LVNLSDGRYAKMNVALVLDHGQPTAVEAGGHGAPPKPPEGFGTLEQEAVIRDIVTDVVT
FT                   NIDGDQLIRTEGRERVKAEILTKIRRTTDVRTEDVLITDVAVQ"
     atgagaaaga acgtcgtcgt cctcgtgctg gtggccttga tcgccggcgc gggcgccgcc        60
     tacaccttcg cgaagccgaa gaaggaagtc agacacaaga tcgacggcgc cgtctacgtg       120
     ctgccgaagg agttcctcgt caacctcagc gacggccgct acgcgaagat gaacgtcgcg       180
     ctcgtgctcg accacggcca gccgacggcg gtggaggcag gcgggcacgg cgcgccgccg       240
     aagccgccgg agggcttcgg cacgctcgag caggaggccg tcatccgcga catcgtcacc       300
     gacgtcgtca cgaacatcga cggcgaccag ctgatcagaa ccgagggccg cgagagagtc       360
     aaggcggaga tcctcacgaa gatcagaaga acgaccgacg tgagaaccga ggacgtcctg       420
     atcaccgacg tcgcggtcca gtag                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page