(data stored in ACNUC7421 zone)

EMBL: CP001854.PE55

CP001854.PE55        Location/Qualifiers
FT   CDS_pept        52426..52818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0055"
FT                   /product="flagellar motor switch protein FliN"
FT                   /note="TIGRFAM: flagellar motor switch protein FliN; PFAM:
FT                   surface presentation of antigens (SPOA) protein; KEGG:
FT                   cja:CJA_1724 flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48491"
FT                   /db_xref="GOA:D3F408"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:D3F408"
FT                   /inference="protein motif:TFAM:TIGR02480"
FT                   /protein_id="ADB48491.1"
FT                   /translation="MSHEMELPAFDRPTAANGSHTGQNDLGRLSDVPVELAVEIGRTRM
FT                   TVGETLELRPGSIVVLNRMAGEPVDLLVNGTPIAHGEVVVIDEEFGLRITDVLGAPAGE
FT                   QNGRASGEASAADASGQSPAEAPGTV"
     atgagccacg agatggagct gcccgcgttc gaccgcccga cggcggcgaa cggcagccac        60
     acgggtcaga acgacctcgg ccgcctcagc gacgtgccgg tcgagctggc ggtcgagatc       120
     ggccgcacgc ggatgaccgt cggcgagacg ctggagctgc ggcccggctc gatcgtcgtg       180
     ctcaaccgga tggccggcga gccggtcgac ctgctcgtca acggcacccc gatcgcccac       240
     ggcgaggtcg tcgtgatcga cgaggagttc ggcctgcgca tcaccgacgt gctcggcgcg       300
     ccggccggtg agcagaacgg ccgcgcctcc ggcgaggcgt ccgcggcgga cgcctccggc       360
     cagtcgcccg ccgaggcgcc aggaaccgtc tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page