(data stored in ACNUC7421 zone)

EMBL: CP001854.PE56

CP001854.PE56        Location/Qualifiers
FT   CDS_pept        52896..53384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0056"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; SMART: CheW domain
FT                   protein; KEGG: dds:Ddes_1022 CheW protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48492"
FT                   /db_xref="GOA:D3F409"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:D3F409"
FT                   /inference="protein motif:PFAM:PF01584"
FT                   /protein_id="ADB48492.1"
FT                   /translation="MSEGQTTRQLVVFSLGEEEYALPITQVHEIIRYTEPRSVASDVDW
FT                   VRGVISLRGKIVPVYDLASRLGFASERKDSAKIVIVETATDMAGVVVDDVEEVLTVESS
FT                   QIEDVPAADNESIEAIAKIDDRLVILLNPAGIFASAASVAAAAETSASGNGVADLVHA"
     atgtccgaag gccagaccac acgtcagctc gtcgtcttct cgctcggcga ggaggagtac        60
     gccctgccga tcacgcaggt ccacgagatc atccggtaca ccgagccgcg ctcggtcgcc       120
     tcggacgtcg actgggtccg tggcgtgatc agcctgcgcg gcaagatcgt gcccgtctac       180
     gacctcgcct cgcggctcgg cttcgcgtcc gagcgcaagg acagcgccaa gatcgtgatc       240
     gtcgagacgg cgaccgacat ggccggcgtc gtcgtcgacg acgtcgagga ggtcctgacc       300
     gtcgagtcct cgcagatcga ggacgtcccg gcggccgaca acgagtcgat cgaggcgatc       360
     gcgaagatcg acgaccgcct cgtgatcctg ctgaaccccg ccggcatctt cgcctccgcc       420
     gcgtccgtcg cggccgccgc cgagacgagc gcgagcggca acggcgtcgc cgacctggtc       480
     cacgcgtag                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page