(data stored in ACNUC7421 zone)

EMBL: CP001854.PE57

CP001854.PE57        Location/Qualifiers
FT   CDS_pept        53423..54553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0057"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /note="PFAM: CheB methylesterase; response regulator
FT                   receiver; SMART: response regulator receiver; KEGG:
FT                   dma:DMR_33480 chemotaxis response regulator
FT                   protein-glutamate methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48493"
FT                   /db_xref="GOA:D3F410"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:D3F410"
FT                   /inference="protein motif:PFAM:PF01339"
FT                   /protein_id="ADB48493.1"
FT                   /translation="MSSATATRVVVADDSGLMRRVVTATLEHSGFTVVGAAKDGDEALA
FT                   LCERERPDAMTLDLAMPGLDGIGVLRALRRQGERATPVVVVSAFSPAHGARAVDALAEG
FT                   AFDLVAKPAVGDGIERFTNELSDKVRLAAASRRGRTRPHGGRAGTGAAAAAGRAAAAPA
FT                   AARPRTAAGSGAVRRAERRVRAHAGTRRVVVIACSTGGPKALAELVPALPAPLGAGTLI
FT                   VQHMPPGFTNSLAARLDRASNLNVREAAGGEALDPKVALLAPGGAHLRLAEPSRVVSLS
FT                   DAPEIGGLRPRADLTIADAAKAFGERMVLVVLTGMGKDGLEGAREVRRRGGRVLVEAES
FT                   TCTVYGMPRAVAEADLADEILPLHELPAAIAAEAGA"
     atgtcgagcg ccactgccac tcgcgtcgtc gtcgcggacg actccggcct gatgcgccgg        60
     gtcgtcaccg cgacgctcga gcactccggc ttcaccgtcg tcggcgccgc caaggacggt       120
     gacgaggcgc tcgcgctgtg cgagcgggag cgtcccgacg cgatgacgct tgacctcgcg       180
     atgcccggcc tcgacggcat cggcgtgctg agagcgctgc gccgccaggg cgagcgcgcg       240
     acgccggtcg tcgtcgtctc cgccttctcg ccggcgcacg gcgcgcgggc cgtcgacgcg       300
     ctcgccgagg gcgcgttcga cctcgtcgcc aagccggccg tcggcgacgg catcgagcgc       360
     ttcaccaacg agctgagcga caaggtgcgg ctcgcggctg cctcgcgtcg tgggcgcacg       420
     cggccgcacg gcggccgcgc cggcaccggc gccgctgccg ccgccggtcg cgcggctgcc       480
     gcgccggccg ccgctcggcc gcgcacggcc gccggcagcg gcgccgtccg ccgcgcggag       540
     cgccgcgtcc gcgcgcacgc cggcacccgc cgcgtcgtcg tgatcgcctg ctcgaccggc       600
     ggcccgaagg cgctcgccga gctggtcccg gcgctgccgg cgccgctcgg cgccggcacg       660
     ctgatcgtcc agcacatgcc gcccggcttc accaactcgc tcgcggcgcg gctcgaccgt       720
     gcctccaacc tcaacgtccg cgaggcggcc ggcggcgagg cgctcgaccc gaaggtcgcg       780
     ctgctggcac cgggcggcgc gcacctgcgg ctcgccgagc cctcgcgcgt cgtctcgctc       840
     agcgacgcgc ccgagatcgg cggcctgcgc ccgcgcgcgg acctgacgat cgccgacgcc       900
     gcgaaggcat tcggcgagcg gatggtgctc gtcgtcttga cgggtatggg caaggacggc       960
     ctggagggtg cgcgggaggt ccgcagacgc ggcggtcgcg tgctcgtcga ggcggagtcg      1020
     acctgcaccg tctacgggat gccgcgcgcc gtcgcggagg ccgatctcgc cgacgagatc      1080
     ctgccgctgc acgagctgcc cgccgcgatc gccgcggagg ccggagcatg a               1131
//

If you have problems or comments...

PBIL Back to PBIL home page