(data stored in ACNUC7421 zone)

EMBL: CP001854.PE58

CP001854.PE58        Location/Qualifiers
FT   CDS_pept        54550..55410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0058"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /EC_number="2.1.1.80"
FT                   /note="KEGG: aeh:Mlg_0892 MCP methyltransferase, CheR-type;
FT                   PFAM: MCP methyltransferase CheR-type; SMART: MCP
FT                   methyltransferase CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48494"
FT                   /db_xref="GOA:D3F411"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3F411"
FT                   /inference="protein motif:PRIAM:2.1.1.80"
FT                   /protein_id="ADB48494.1"
FT                   /translation="MSATVPGRTSPQGEISRPNPRPQAERFGDDYTAFCEGVRALTSID
FT                   LLQYKRGQMERRIRSFAQRRGAADLPAYLAQLRGDRAELGEFLDRVTINVSQLWRNPEQ
FT                   WRVLETEVLPELLAESSPGRIKAWSAGCSYGAESYTLAALIRQLDPRARAEIVGTDIDR
FT                   RMVERAKLGRFSADDARSAALPLLRRWFTREDDVWQASSELRSLVRFEVGDLLRMPTKR
FT                   AAYDLVLCRNTVIYFTEDVRDALHERLVASLRPGGYLVIGSTERVSHPRELGLVATHPF
FT                   TYRKS"
     atgagcgcca ccgtgcccgg gagaacgagc ccccagggcg agatctcccg accgaacccg        60
     aggccgcagg ccgagcggtt cggcgatgac tacacggcct tctgcgaggg cgtccgcgcg       120
     ctcacgagca tcgacctgct gcagtacaag cgcgggcaga tggagcggcg catccgctcg       180
     ttcgcgcagc gccgcggcgc cgccgacctg cccgcctacc tcgcgcagct gcgcggcgac       240
     agagccgagc tgggcgagtt cctcgaccgc gtgacgatca acgtctcgca gctgtggcgc       300
     aaccccgagc agtggagagt gctggagacc gaggtgctgc cggagctgct ggcggagtcg       360
     tcgcccggcc gcatcaaggc gtggagcgcc ggctgctcgt acggcgccga gtcgtacacg       420
     ctcgccgcgc tgatccggca gctcgatccg agagcacgcg ccgagatcgt cggcaccgac       480
     atcgaccgcc ggatggtcga gagagcgaag ctcggccgct tcagcgccga cgacgcgcgc       540
     agcgccgcac tgccgctgct gagacgctgg ttcacgcgcg aggacgacgt ctggcaggcg       600
     agcagcgagc tgcgctcgct cgtccgcttc gaggtcggcg acctgctgcg gatgccgacc       660
     aagcgcgccg cgtacgacct cgtgctgtgc cgcaacaccg tcatctactt caccgaggac       720
     gtgcgcgatg cgctgcacga acgcctcgtc gcgtcgttgc ggccgggcgg gtacctcgtg       780
     atcggctcga ccgaacgggt cagccacccg cgcgagctgg gactcgtcgc cacccatcca       840
     ttcacgtatc gcaagagcta g                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page