(data stored in ACNUC7421 zone)

EMBL: CP001854.PE59

CP001854.PE59        Location/Qualifiers
FT   CDS_pept        55421..57448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0059"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein; CheW
FT                   domain protein; Hpt domain protein; Signal transducing
FT                   histidine kinase homodimeric; P2 response regulator binding
FT                   domain protein; SMART: Hpt domain protein; ATP-binding
FT                   region ATPase domain protein; CheW domain protein; KEGG:
FT                   geo:Geob_3829 CheA signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48495"
FT                   /db_xref="GOA:D3F412"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR010808"
FT                   /db_xref="InterPro:IPR035891"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="InterPro:IPR037052"
FT                   /db_xref="UniProtKB/TrEMBL:D3F412"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADB48495.1"
FT                   /translation="MDTSEYLPMFLAESREHLQELNLAVVRIEETPDDRDTVDEIFRIA
FT                   HSLKGMSATMGFAAIAALTHQMEDVFELLRQRADGLPREAVDVLFKCLDALEAAVEEIA
FT                   TDGAEQLDPAALIEQLKGLIRERTPEQELDKIGGVDLPDLPTVRELADGSRVVHVAADL
FT                   SDEALMPAVRAFMFFQALAELGELVGSIPAQDGVEQFQGTRLEAWLASDREDHVIEAAA
FT                   AGVSDVEHVAVQEAQDDLMPPSIETLSAAHADAEPALVGGPAVDHAAPARRVATNHAAG
FT                   GAHAGATVRVDAERLDQLMHFMGELVIHRTVVETLAGDADVPGLQQAIQDMARSSQALQ
FT                   AMVMQVRMIPVEAVFLRFPRLVRDLSSKLSKEVELQLVGQETELDRTVVDALGDPLVHL
FT                   VRNALDHGLEPPDEREAAGKPRTGVLEISARHAGGNVVISVRDDGRGVDPAKVAQKAFE
FT                   RGLISEEAIPAVDSQRAAELLFTAGFSTAESTSDISGRGVGMDAVQAKIRELGGEVIVD
FT                   SEFGVGMTASIRLPLTLAIMSALLVEAEGMPFAVPLDRVERTLRLEDHAVRSVAGQRML
FT                   VLRDGVLPLIDAGEALAGRVVPSGEAHDHAVIVRGRDRRLALAVGTLVGQRELVTRPLP
FT                   PEVSDRAAVSGGAVLSNGEISLIVDCDALTARATEPVPVS"
     atggacacct ccgagtatct cccgatgttc ctcgcggagt cccgcgagca cctgcaggag        60
     ctgaacctcg ccgtcgtgcg gatcgaggag acgcctgacg accgcgacac ggtcgacgag       120
     atcttccgca tcgcgcattc gctgaagggc atgagcgcga cgatgggctt cgccgcgatc       180
     gccgccctca cgcaccagat ggaggacgtc ttcgagctgc tgcgccagcg cgccgacgga       240
     ctgccgcgcg aggccgtcga cgtcctcttc aaatgcctcg acgcgctcga ggcggcggtc       300
     gaggagatcg ccaccgacgg cgccgagcag ctcgacccgg ccgcgctgat cgagcagctc       360
     aagggcctga tccgcgagcg cacgcccgag caggagctgg acaagatcgg cggcgtcgac       420
     ctgcccgacc tgccgaccgt gcgcgagctg gccgacggca gccgcgtcgt gcacgtcgcc       480
     gccgacctct ccgacgaggc gctgatgccg gccgtgcgcg cgttcatgtt cttccaggcg       540
     ctcgccgaac tgggcgagct ggtcggctcg atccccgcgc aggacggcgt cgagcagttc       600
     cagggcacgc gcctggaggc gtggctggcg agcgaccggg aggaccacgt gatcgaggcg       660
     gcggccgccg gcgtcagcga cgtcgagcac gtcgccgtgc aggaggcgca ggacgacctg       720
     atgccgccgt cgatcgagac gctctccgcc gcccacgccg acgccgagcc ggcgctcgtc       780
     ggcggcccgg ccgtcgacca cgccgcgccc gccagacgcg tcgcgaccaa ccacgcggcc       840
     ggcggcgcgc acgccggcgc gaccgtgcgc gtcgacgccg agcggctcga ccagctgatg       900
     cacttcatgg gcgagctcgt gatccaccgg accgtcgtcg agacgctcgc cggcgacgcc       960
     gacgtgcccg gcctgcagca ggcgatccag gacatggcgc gcagctcgca agcgctccag      1020
     gcgatggtga tgcaggtccg gatgatcccg gtcgaggcgg tcttcctgcg cttcccgcgg      1080
     ctcgtgcgcg acctttcctc caagctctcc aaggaggtcg agctgcagct cgtcggccag      1140
     gagacggagc tggatcggac cgtcgtcgac gcgctcggcg acccgctcgt gcacctcgtc      1200
     cgcaacgcgc tcgaccatgg gctcgaaccg cccgacgagc gcgaggccgc gggcaagccg      1260
     cgcaccggcg tgctggagat ctccgcccgc cacgccggcg gcaacgtcgt catcagcgtg      1320
     cgcgacgacg gccgcggggt cgatcccgcg aaggtcgcgc agaaggcgtt cgagcgcggc      1380
     ctgatcagcg aggaggcgat tccggcggtc gactcccagc gcgccgccga gctgctcttc      1440
     acggccggct tctcgaccgc cgagtcgacc agcgacatct cgggccgcgg cgtcgggatg      1500
     gacgccgtgc aggcgaagat ccgcgagctg ggcggcgagg tgatcgtcga ctccgagttc      1560
     ggcgtcggga tgaccgcgtc gatccggttg ccgctgacgc tggcgatcat gtcggcgctg      1620
     ctggtcgagg ccgaggggat gccgttcgcg gtcccgctcg accgcgtcga gcgcacgctg      1680
     cggctggagg accacgccgt ccgctcggtc gccggccagc gcatgctcgt gctgcgcgac      1740
     ggcgtgctgc cgctgatcga cgccggcgag gcgctcgccg gccgcgtcgt gccctccggc      1800
     gaggcgcacg accacgccgt gatcgtgcgt ggccgcgatc gccgcctggc gctcgccgtc      1860
     ggcaccctcg tcggccagcg cgagctggtc acgcgtccgc ttccgcccga ggtcagcgac      1920
     cgcgccgccg tctccggcgg cgccgtgctg tccaacggcg agatctcgct catcgtcgac      1980
     tgcgacgccc tcacggcgcg cgcgaccgaa cccgtcccgg tgtcctga                   2028
//

If you have problems or comments...

PBIL Back to PBIL home page