(data stored in ACNUC7421 zone)

EMBL: CP001854.PE6

CP001854.PE6         Location/Qualifiers
FT   CDS_pept        6720..9371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: azo:azo1066 DNA gyrase subunit A; TIGRFAM: DNA
FT                   gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48442"
FT                   /db_xref="GOA:D3EYQ9"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYQ9"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADB48442.1"
FT                   /translation="MSATDQLSGGNIEPRALEEEMRSAYLDYAMSVIVGRALPDVRDGL
FT                   KPVHRRVLFAMNEMGVQPNRPRAKSSRIVGEVMGKYHPHGDASIYDTLVRMAQDFSMRH
FT                   LLVDGQGNFGSVDDDPAAAMRYTEARLARIATEMLRDIDADTVDFGPNYDGKNQEPLVL
FT                   PARFPNLLVNGSSGIAVGMATNIPPHNLRETIAATIAYIENPEIDVDGLMQHIRGPDFP
FT                   TGGIILGVGGIRDAYATGRGRVRVQARAHIEPLSQGKEAIVVTELPYQVKKGGDGGLIQ
FT                   KIADLVHEKKIPEITDLRDESDRHGMRFVIELKRDVLPKVVLNKLYKHTPMQTTFGVNM
FT                   VALVDNVPKTLSLREVIGRYVDHQREVIVRRTKYELRRAEDRAHILEGLLIAQANIDEV
FT                   IAIIRRSSDREQARINLVNRFELSERQAEAILQMTLGRLTALEVDKLRQEHADLMERIR
FT                   ELREILGDEDRQMAIIKEELQEISDAYGNERRTAISYAEGEIDIEDLIADQQMVITITK
FT                   TGYIKSLPLATYRQQRRGGVGVTGMDMKDGDYIEHLFVTSTHDFLLFFTNRGKVYRSKV
FT                   YELPEASRTAKGRALVNILPLREGERVQSVLSTRDFSEAPYLLFATRKGTVKKTELQAY
FT                   NTPIKADGIIAIKIRDDDELVAVRRVDEGDEVIIVSRAGLTVRFSEQDARSMGRDTSGV
FT                   RGMDVGDSGEVIAMDIARDDQDLLVITENGFGKRTRIDEYRKTARGAKGVRTIRLTEAR
FT                   GGLAGALVVREHQELVFISQNGMVQRTGVRGINRYGRASQGVKVMNVREDDSVRAIALV
FT                   VESDTAEADEALELELGADGVEGGGVVAVDADGAGADGGAPASDASDAPQGDDGDEPPA
FT                   DGDSSSEGDAEV"
     atgagcgcta ccgatcagct cagcggcggc aacatcgagc cgcgcgcgct cgaggaggag        60
     atgcgctcgg cgtatctcga ctacgcgatg tccgtcatcg tcgggcgcgc cctgcccgac       120
     gtccgcgatg gcctgaagcc cgtccaccgt cgcgtgctct tcgcgatgaa cgagatgggc       180
     gtgcagccca accgcccgcg cgcgaagtcc tcccgcatcg tcggcgaggt gatgggcaag       240
     taccacccgc acggcgacgc gtcgatctac gacacgctcg tgcggatggc gcaggacttc       300
     tcgatgcgcc acctgctcgt cgacgggcag gggaacttcg gctcggtcga cgacgacccg       360
     gcggccgcga tgcggtacac cgaggcgcgg ctggcgagga tcgccaccga gatgctccgc       420
     gacatcgacg cggacaccgt cgacttcggg cccaactacg acggcaagaa ccaggagccg       480
     ctggtcctcc cggcgcgctt cccgaacctg ctcgtcaacg gctcgtccgg catcgccgtc       540
     gggatggcga cgaacatccc gccgcacaac ctcagagaga cgatcgccgc gacgatcgcg       600
     tacatcgaga accccgagat cgacgtcgac gggctgatgc agcacatcag aggcccggac       660
     ttcccgaccg gcggcatcat cctcggcgtc ggcggcatcc gcgacgccta cgcgaccggc       720
     cgcggccgcg tgcgcgtgca ggcgcgtgcg cacatcgagc cgctctcgca gggcaaagag       780
     gcaatcgtcg tcaccgagct gccgtaccag gtcaagaagg gcggcgacgg cgggctgatc       840
     cagaagatcg cggacctcgt ccacgagaag aagatccccg agatcaccga cctgcgcgac       900
     gagtcagacc gtcacggcat gcgcttcgtg atcgagctga agcgcgacgt gctgccgaag       960
     gtggtgctga acaagctcta caagcacacg ccgatgcaga cgacgttcgg cgtgaacatg      1020
     gtcgcgctcg tcgacaacgt gccgaagacg ctctcgctgc gcgaggtcat cgggcgctac      1080
     gtcgaccacc agcgcgaggt gatcgtccgc cggacgaagt acgagctgcg ccgggccgag      1140
     gatcgcgctc acatcctcga aggcctcctg atcgcgcagg cgaacatcga cgaggtcatc      1200
     gcgatcatcc gcagatcgtc cgatcgcgag caggcccgca tcaacctcgt caacagattc      1260
     gagctgagcg agcggcaggc cgaggcgatc ctgcagatga cgctcggccg cctcacggcg      1320
     ctcgaggtcg acaagctcag acaggagcac gccgacctga tggagcggat ccgcgagctg      1380
     cgcgagatcc tcggcgacga agaccgccag atggcgatca tcaaggagga gctgcaggag      1440
     atctccgacg cgtacggcaa cgagcgccgc accgcgatct cctacgccga gggcgagatc      1500
     gacatcgagg acctgatcgc cgaccagcag atggtcatca cgatcacgaa gacgggctac      1560
     atcaagtccc tgccgctcgc cacctaccgc cagcagcgac gcggcggcgt cggtgtgacc      1620
     gggatggaca tgaaggacgg cgactacatc gagcacctgt tcgtgacctc gacgcacgac      1680
     ttcctgctgt tcttcacgaa ccgcggcaag gtctaccgct cgaaggtgta cgagctgccc      1740
     gaggcgtcgc gcaccgcgaa ggggcgcgcg ctcgtcaaca tcctgccgtt gcgcgaaggc      1800
     gagcgggtcc agtccgtcct ctcgacgcgt gacttctccg aggcgccgta cctgttgttc      1860
     gcgacccgca agggcacggt caagaagacc gagctgcagg cgtacaacac gccgatcaag      1920
     gccgacggca tcatcgcgat caagatccgc gacgacgacg agctggtcgc cgtgcgccgg      1980
     gtcgacgagg gcgacgaggt catcatcgtc tcgcgcgccg ggctgaccgt ccgcttcagc      2040
     gagcaggacg ctcgctcgat gggtcgcgac accagcggcg tgcgcgggat ggacgtcggt      2100
     gacagcggcg aggtcatcgc gatggacatc gcgcgcgacg accaggacct gctcgtgatc      2160
     accgagaacg gcttcggcaa gcgcacgcgg atcgacgaat accgcaagac cgcgcgcggc      2220
     gcgaagggcg tcagaacgat cagactgacc gaggcgcgcg gcgggctcgc cggcgcgctc      2280
     gtcgtgcgcg agcaccagga gctcgtcttc atctcccaga acggcatggt ccagcggacc      2340
     ggcgtgcgtg gcatcaaccg ctacggccgc gcgtcgcagg gcgtcaaggt catgaacgtg      2400
     cgcgaggacg acagcgtccg cgcgatcgcg ctcgtggtcg agtccgacac cgcggaggcc      2460
     gatgaggcgc tcgagctgga gctcggcgcg gacggcgtcg agggcggtgg cgtcgtcgcg      2520
     gtcgacgccg acggagccgg cgcggacggc ggcgcgccag catccgacgc gtcggatgcg      2580
     ccgcagggcg atgacgggga cgagccgccg gccgacggcg actcctcctc cgagggcgac      2640
     gcagaagtct ga                                                          2652
//

If you have problems or comments...

PBIL Back to PBIL home page