(data stored in ACNUC7421 zone)

EMBL: CP001854.PE60

CP001854.PE60        Location/Qualifiers
FT   CDS_pept        57475..58071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0060"
FT                   /product="CheC, inhibitor of MCP methylation"
FT                   /note="PFAM: CheC domain protein; KEGG: gur:Gura_0720 CheC,
FT                   inhibitor of MCP methylation"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48496"
FT                   /db_xref="GOA:D3F413"
FT                   /db_xref="InterPro:IPR007597"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:D3F413"
FT                   /inference="protein motif:PFAM:PF04509"
FT                   /protein_id="ADB48496.1"
FT                   /translation="MSSDFTELQLDAMRELANIGSGNAATALASMLGREVELSVPRALA
FT                   LPLADAVDAVGPAEKTVASVVLPIVGDLEALVLLLFPTQDAAALCGLLGVEPGTEVGDS
FT                   AIGEIGNILGTSYINALASMAGIAIEPRPPHVVTDMLGAIVASLLAGTAGESGVALVLD
FT                   SELDVADAACSLSFLLLPTTGGIDELLTRLGVGGS"
     gtgtcgtccg acttcaccga gctgcagctc gacgccatgc gagagctggc aaacatcggg        60
     tccggcaacg ccgcgaccgc gctcgcgagc atgctcggcc gcgaggtcga gctgtcggtc       120
     ccgcgtgcgc tggcgctccc gctcgccgac gcggtcgacg cggtcgggcc cgccgagaag       180
     acggtcgcga gcgtcgtgct gccgatcgtc ggcgacctcg aggcgctcgt gctgctgctg       240
     ttcccgacgc aggacgccgc ggcgctctgc ggcctgctcg gcgtcgagcc gggcaccgag       300
     gtcggcgact cggcgatcgg cgagatcggc aacatcctcg gcacctcgta catcaacgcg       360
     ctcgcgtcga tggcgggaat cgcgatcgag ccgcgcccgc cgcacgtcgt caccgacatg       420
     ctcggcgcga tcgtcgcgtc gctgctcgcc ggcaccgccg gcgagtcggg cgtcgcgctc       480
     gtgctcgact ccgagctgga cgtcgccgac gccgcctgct cgctctcgtt cctgctgctg       540
     ccgaccaccg gtgggatcga cgagctgctg acccgcctcg gcgtcggagg ctcctga          597
//

If you have problems or comments...

PBIL Back to PBIL home page