(data stored in ACNUC7421 zone)

EMBL: CP001854.PE61

CP001854.PE61        Location/Qualifiers
FT   CDS_pept        58094..58615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0061"
FT                   /product="CheD, stimulates methylation of MCP protein"
FT                   /note="PFAM: CheD family protein; KEGG: dat:HRM2_34420
FT                   CheD1"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48497"
FT                   /db_xref="GOA:D3F414"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/TrEMBL:D3F414"
FT                   /inference="protein motif:PFAM:PF03975"
FT                   /protein_id="ADB48497.1"
FT                   /translation="MRIVRMGELAVSATPGDELTSIGLGSCIGVALVDRARGVAALAHV
FT                   MLPDATADLDAPAGKYADRAIPALVAAAEELGARRVRLEAVLVGGAQMFDVGVGSALDI
FT                   GARNAVAVRAALQSARIPVRAEQVGGRRGRTMRVHVDPLHVTVKEAGGREAELWNGSPT
FT                   ARRSAAEVTH"
     gtgaggatcg tgcggatggg cgagctcgcc gtcagcgcga cgccgggcga cgagctgacc        60
     tcgatcggtc tcggctcgtg catcggcgtg gcgctggtcg accgcgccag aggcgtcgcc       120
     gcgctcgccc acgtgatgct ccctgacgcg acggccgacc tcgacgcgcc ggccggcaag       180
     tacgccgacc gcgcgatccc ggcgctcgtc gccgcggcag aggagctggg tgcccgccgc       240
     gtgcggctgg aggccgtgct cgtcggcggc gcgcagatgt tcgacgtcgg cgtcggcagc       300
     gcgctcgaca tcggtgcgcg caacgccgtc gccgtgcgcg ccgcgctgca gagcgcgcgc       360
     atccccgtgc gcgccgagca ggtcggcggc cgccgcgggc gcacgatgcg cgtgcacgtc       420
     gacccgctgc acgtgaccgt gaaggaagcc ggcggcagag aggcggagct gtggaacggc       480
     tcgcccaccg cacgacgcag cgcagcggag gtgacccact ag                          522
//

If you have problems or comments...

PBIL Back to PBIL home page