(data stored in ACNUC7421 zone)

EMBL: CP001854.PE62

CP001854.PE62        Location/Qualifiers
FT   CDS_pept        58616..59584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0062"
FT                   /product="surface presentation of antigens (SPOA) protein"
FT                   /note="PFAM: surface presentation of antigens (SPOA)
FT                   protein; KEGG: nam:NAMH_1346 flagellar motor switch protein
FT                   FliM"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48498"
FT                   /db_xref="GOA:D3F415"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:D3F415"
FT                   /inference="protein motif:PFAM:PF01052"
FT                   /protein_id="ADB48498.1"
FT                   /translation="MSEILTNDQIAALVEAAKHGELPDDSAATRRGRRLKTVDFARPTK
FT                   FTSEQERRIVRTLDMFCQTAAARLTAELRVPLELEVINTTQLTWSAAQQQLPPASLGTP
FT                   LEVAPHDTRMLMTAELPFVLMAIEYLLGGAPERPPRQRKLSEIDWVLSKRLFETLTTQL
FT                   SIVWQDLAGQTLAAQEVDSHVEGMQVAAISEPTLTITLESRINRHSSTLALLIPWVSID
FT                   PVADQIAGRDLRTRADDPRAAALVQAALSGAHVTMRAEVGSVEMAIDDVLGLAPGDLVK
FT                   LSSLAADGVVVYAEDVPIHHAQPGRSGARRAVQIVDRREQS"
     atgagcgaga tcctcaccaa cgatcagatc gccgcgctcg tcgaggcggc caagcacggc        60
     gagctgcccg acgactcggc cgcgacgagg cggggacgcc ggctcaagac cgtcgacttc       120
     gcgcgcccga cgaagttcac cagcgagcag gagcggagga tcgtccgcac gctcgacatg       180
     ttctgccaga cggccgccgc gcgcctgacg gcggagctgc gcgtgccgct ggagctggag       240
     gtcatcaata cgacgcagct gacgtggtcg gccgcgcagc agcagctgcc gccggcgtcg       300
     ctcggcacgc cgctggaggt ggcgccgcac gacacgcgga tgctgatgac ggccgagctg       360
     ccgttcgtgc tgatggcgat cgagtacctg ctcggcggcg cgcccgagag accgccgcgt       420
     cagcgcaagc tgagcgagat cgactgggtc ctctccaagc gcctgttcga gacgctcacg       480
     acgcagctgt cgatcgtctg gcaggacctc gcggggcaga cgctcgccgc gcaggaggtc       540
     gactcgcacg tcgagggcat gcaggtcgcc gcgatctccg agccgacgct gacgatcacg       600
     ctggagtcgc gcatcaaccg ccactcctcg acgcttgcgc tgctgatccc gtgggtgtcg       660
     atcgaccccg tcgccgacca gatcgccggc cgcgacctgc gcacgcgcgc cgacgacccg       720
     cgtgccgccg cgctcgtgca ggccgcgctg tcgggcgccc acgtgaccat gcgagccgag       780
     gtcggcagcg tcgagatggc gatcgacgac gtgctcgggc tcgcgcccgg cgacctcgtc       840
     aagctctcct cgctcgccgc cgacggcgtc gtcgtctacg ccgaggacgt gccgatccac       900
     cacgcgcaac cgggccgcag cggcgcccgc cgcgccgtcc agatcgtcga ccggcgggag       960
     cagtcgtga                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page