(data stored in ACNUC7421 zone)

EMBL: CP001854.PE63

CP001854.PE63        Location/Qualifiers
FT   CDS_pept        59581..60486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0063"
FT                   /product="CheC, inhibitor of MCP methylation"
FT                   /note="PFAM: surface presentation of antigens (SPOA)
FT                   protein; CheC domain protein; KEGG: tgr:Tgr7_1329 flagellar
FT                   motor switch protein FliN"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48499"
FT                   /db_xref="GOA:D3F416"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR007597"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:D3F416"
FT                   /inference="protein motif:PFAM:PF01052"
FT                   /protein_id="ADB48499.1"
FT                   /translation="MNTRDALMRLGASTAEAIAKVLDSLCPDQVERGDVAVLNPDTNPF
FT                   ATLEAPAVAVSVAYVDGVTGANVFVMTAKGARRIAASMMGQPPPEDDASELSVLELSAV
FT                   AEAANQMMAAAAAAIGVVLGQDVEIAPPETRLFNSASEAIDAYEMAPHGARATFRVCDE
FT                   PCRLVQLVPNAFVVRMTRALDEMGVEHVSGGASDGGEGDVHEQVALDDALRDIRVRVWA
FT                   ELGRTRVPLGQAPDMPAGSVLELDRKADDPVDLYVNGLRFASGTLVLTDDGEWALRLAE
FT                   VAGRDASDLQRTPDKEGTVS"
     gtgaacacca gagacgcatt gatgcgcctc ggcgcctcga ccgccgaggc gatcgcaaag        60
     gtgctcgaca gcctctgccc cgaccaggtc gagcgcggcg acgtcgcggt cctcaacccc       120
     gacacgaacc cgttcgcgac gctggaggcg cccgctgtgg cggtcagcgt cgcctacgtc       180
     gacggcgtca ccggcgccaa cgtcttcgtc atgacggcga agggcgcgcg ccgcatagcg       240
     gcctcgatga tgggccagcc gccgccggag gacgacgcca gcgagctgtc cgtgctggag       300
     ctgtcggccg tcgccgaggc ggcgaaccag atgatggccg cggccgccgc cgcgatcggc       360
     gtcgtgctcg gccaggacgt cgagatcgcg ccgccggaga cgcgcctctt caacagcgcc       420
     tcggaggcga tcgacgccta cgagatggcc ccgcacggcg cccgcgcgac gttccgcgtc       480
     tgcgacgagc cgtgccgcct cgtgcagctc gtgccgaacg cgttcgtcgt gcggatgacg       540
     cgcgcgctcg acgagatggg cgtcgagcac gtcagcggcg gcgcctccga cggcggcgag       600
     ggcgacgtcc acgagcaggt cgcgctcgac gacgcgctgc gcgacatccg cgtgcgcgtc       660
     tgggccgagc tgggacgcac gcgcgttccg ctcgggcagg cgcccgacat gcccgccggc       720
     tccgtcctcg agctcgaccg caaggcggac gaccccgtcg acctgtacgt caacggcctg       780
     cgcttcgcga gcgggacgct cgtcctcacc gacgacggtg aatgggcgct gcggctcgcc       840
     gaggtcgccg gccgcgacgc atccgatctg caacgaaccc ccgacaagga aggaacggtg       900
     tcctga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page