(data stored in ACNUC7421 zone)

EMBL: CP001854.PE64

CP001854.PE64        Location/Qualifiers
FT   CDS_pept        60486..60845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0064"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: mxa:MXAN_6693 fibril biogenesis
FT                   regulator DifD"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48500"
FT                   /db_xref="GOA:D3F417"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D3F417"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADB48500.1"
FT                   /translation="MARVLVVDDAAFMRKMLTDALSNGGHEVVGEAGNGVEAIQRFQEL
FT                   RPELITLDITMPEKDGLEALREIMAIDPSAKVVMCSALGQEAKVLESIKLGAKDFVVKP
FT                   FQADRVLDAVGKALA"
     atggcacgtg tgctcgtcgt cgatgacgct gcgttcatgc gcaagatgct gaccgacgcg        60
     ctctccaacg gcggccatga ggtcgtcggg gaggccggca acggcgtgga ggcgatccag       120
     cgcttccagg agctgcgccc cgagctgatc acgctcgaca tcaccatgcc cgagaaggac       180
     ggcctggagg cgctgcgcga gataatggcg atcgacccca gcgcgaaggt cgtgatgtgc       240
     tcggcgctgg gccaggaggc gaaggtgctg gagtcgatca agcttggcgc gaaggacttc       300
     gtcgtcaagc cgttccaggc cgatcgggtc ctggacgcgg tcggaaaagc cctcgcctag       360
//

If you have problems or comments...

PBIL Back to PBIL home page