(data stored in ACNUC7421 zone)

EMBL: CP001854.PE65

CP001854.PE65        Location/Qualifiers
FT   CDS_pept        60951..61520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0065"
FT                   /product="flagellar biosynthesis protein FliO"
FT                   /note="PFAM: flagellar biosynthesis protein FliO; KEGG:
FT                   bvi:Bcep1808_0048 flagellar biosynthesis protein, FliO"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48501"
FT                   /db_xref="GOA:D3F418"
FT                   /db_xref="InterPro:IPR022781"
FT                   /db_xref="UniProtKB/TrEMBL:D3F418"
FT                   /inference="protein motif:PFAM:PF04347"
FT                   /protein_id="ADB48501.1"
FT                   /translation="MIKASLLPRVVALCAALFTVLCTPALAAGGARDAESTPVDLPTTT
FT                   QPSGDVGGGSGSIVRTIVGLAIVIGVIYGIAWVLRQMKQSKAERSIGGLASVASVALGS
FT                   GKALHLVRAGNELVLVGVADHGVTPVRTYTEQEAQDAGLIDEWGELILPDGAAEPRARA
FT                   ADAGRGAKVPVPGALVETMRKWTVRR"
     atgatcaagg cttccctgct tccacgggtg gtcgcgctct gcgctgccct cttcaccgtg        60
     ctctgcacgc ccgccctcgc ggccggcggc gccagagacg ctgagagcac ccccgtcgac       120
     ctccccacca cgacgcagcc gtcgggcgac gtcggcggcg gcagtggcag catcgtccgc       180
     acgatcgtcg gcctggcgat cgtgatcggc gtcatctacg ggatcgcctg ggtcctcaga       240
     cagatgaagc agagcaaggc cgagcgctcg atcggcgggc tcgcctccgt cgcctcggtc       300
     gcgctcggct ccggcaaggc gctgcacctc gtgcgcgccg gcaacgagct ggtgctcgtc       360
     ggcgtcgccg accacggcgt cacgccggtt cgcacctaca ccgagcagga ggcgcaggac       420
     gccggcctga tcgacgagtg gggcgagctg atcctgcccg acggcgccgc cgagccgcgt       480
     gctcgcgccg ccgacgccgg caggggcgcg aaggtcccgg tgccgggtgc cctcgtcgag       540
     acgatgcgca agtggacggt gcgacggtga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page