(data stored in ACNUC7421 zone)

EMBL: CP001854.PE66

CP001854.PE66        Location/Qualifiers
FT   CDS_pept        61517..62158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0066"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FliP; PFAM:
FT                   type III secretion system inner membrane P protein; KEGG:
FT                   bba:Bd3325 flagellar biosynthesis protein FliP"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48502"
FT                   /db_xref="GOA:D3F419"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:D3F419"
FT                   /inference="protein motif:TFAM:TIGR01103"
FT                   /protein_id="ADB48502.1"
FT                   /translation="MNTVDGDSAIQVLLLIGAFTLIPAGLFCLTGFTRILIVLGFIRTA
FT                   IGTPTAPPNQVLVGIALFLTLFVMAPTFTQIKETAWDPLEAGRINTAQAVRRAEEPLRQ
FT                   FMFEQTRTKDLALFVRLSRTREQPRTRADIPTTVLIPAFIVSELKTAFQIGFMIFLPFL
FT                   VIDLIVASTLMSMGMIMLPPVFISLPFKILLFVLVDGWALITDSLVRSFN"
     gtgaacacgg tcgacggcga cagcgcgatc caggtcctgc tgctgatcgg cgccttcacg        60
     ctgatcccgg ccggcctctt ctgcctcacc ggcttcacgc gcatcctgat cgtgctcggc       120
     ttcatccgca ccgcgatcgg cacgccgacg gcgccgccga accaggtgct cgtcgggatc       180
     gcgctgttcc tgacgctgtt cgtgatggcg ccgaccttca cgcagatcaa ggagaccgcc       240
     tgggatccgc tggaggccgg cagaatcaac accgcccagg cggtcagacg cgccgaggag       300
     ccgctgcgtc agttcatgtt cgagcagacg cgcacgaagg acctcgcgct gttcgtgcgg       360
     ctgtcgagaa cgagagagca gccgagaacg cgcgccgaca tcccgacgac cgtcctgatc       420
     ccggcgttca tcgtcagcga gctgaagacg gcgttccaga tcggcttcat gatcttcctg       480
     ccgttcctgg tgatcgacct gatcgtcgcc tcgaccttga tgagcatggg gatgatcatg       540
     ctcccaccgg tcttcatctc gctgccgttc aagatcctgc tgttcgtgct cgtcgacggc       600
     tgggcgctga tcaccgactc gctggtccga agtttcaact ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page