(data stored in ACNUC7421 zone)

EMBL: CP001854.PE67

CP001854.PE67        Location/Qualifiers
FT   CDS_pept        62172..62447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0067"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FliQ; PFAM:
FT                   export protein FliQ family 3; KEGG: ent:Ent638_2540
FT                   flagellar biosynthesis protein FliQ"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48503"
FT                   /db_xref="GOA:D3F420"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:D3F420"
FT                   /inference="protein motif:TFAM:TIGR01402"
FT                   /protein_id="ADB48503.1"
FT                   /translation="MDQDTVMNLSTQALDLAIKIGGPLLLVGLVVGLVVSVFQAITQIQ
FT                   EQSLSFIPKIIATAVVLVVAGPWMLNQLIAYTENLYRSIPTLVGGG"
     atggatcaag acaccgtcat gaacctgtcg acgcaggcgc tcgacctcgc gatcaagatc        60
     ggcgggccgc tgctgctcgt cggcctcgtc gtcggcctcg tcgtctccgt cttccaggcg       120
     atcacgcaga tccaggagca gagcctctcg ttcatcccga agatcatcgc gacggccgtc       180
     gtgctcgtcg tcgccggtcc gtggatgctg aaccagctga tcgcgtacac cgagaacctc       240
     taccgctcga tcccgacgct ggtcggtggc ggatga                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page