(data stored in ACNUC7421 zone)

EMBL: CP001854.PE68

CP001854.PE68        Location/Qualifiers
FT   CDS_pept        62444..63244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0068"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FliR; PFAM:
FT                   type III secretion system inner membrane R protein; KEGG:
FT                   dds:Ddes_0193 flagellar biosynthetic protein FliR"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48504"
FT                   /db_xref="GOA:D3F421"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:D3F421"
FT                   /inference="protein motif:TFAM:TIGR01400"
FT                   /protein_id="ADB48504.1"
FT                   /translation="MNATQTTANQLLAALGVRNVVGFFLVLARVSPLFLVAPMFNSRQV
FT                   PARARTIVALAFALGLYPLAVAGQTLPTEAFAIVGLIVKEMLVGLAFALCVSVMFAAVD
FT                   AAGTLLDFMVGFAFGGSLDPITGNQSAVLARVYSLVAVAIFIAINGDAWLIQGMSRTFD
FT                   IVPLSASPDFASISQGVVAVFTTIFASALAVAAPVLIACVLTDVAFGLVSRVVPQMNVF
FT                   AVGFPVKVIVGLVVVAASLPFVGGWISDQLQLSVGEALQTLRMG"
     atgaacgcga cgcagacgac ggcgaaccag ctgctcgccg cgctcggcgt cagaaacgtc        60
     gtcggcttct tcctcgtgct cgcgcgcgtc agcccgctct tcctcgtcgc gccgatgttc       120
     aactcgcggc aggttccggc gcgcgcgaga acgatcgtcg cgctcgcctt cgcgctcggc       180
     ctctacccgc tcgcggtcgc cggccagacg ctgccgacgg aggcgttcgc gatcgtcggc       240
     ctgatcgtca aggagatgct cgtcggcctc gcgttcgcgc tctgcgtctc ggtcatgttc       300
     gccgccgtcg acgccgccgg cacgctgctc gacttcatgg tcggcttcgc gttcggcggc       360
     tcgctcgacc cgatcaccgg caaccagtcg gccgtgctgg cgcgcgtcta cagcctcgtc       420
     gcggtcgcga tcttcatcgc gatcaacggc gacgcctggc tgatccaggg gatgtcgcgc       480
     acgttcgaca tcgtcccgct gtcggcgtcg cccgacttcg cctcgatctc gcagggcgtc       540
     gtcgccgtct tcacgacgat cttcgcgtcc gcgctcgcgg tcgccgcgcc ggtcctgatc       600
     gcgtgcgtgc tgaccgacgt cgcgttcggt ctcgtctcgc gcgtcgtgcc gcagatgaac       660
     gtcttcgcgg tcggcttccc ggtcaaggtg atcgtcggcc tcgtcgtcgt cgcggcgtcg       720
     ctgccgttcg tcggcggctg gatctcggat cagctccagc tgagcgtcgg cgaggcgctc       780
     cagaccctcc ggatgggcta g                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page