(data stored in ACNUC7421 zone)

EMBL: CP001854.PE69

CP001854.PE69        Location/Qualifiers
FT   CDS_pept        63248..64324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0069"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FlhB; PFAM:
FT                   type III secretion exporter; KEGG: dal:Dalk_1004 flagellar
FT                   biosynthetic protein FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48505"
FT                   /db_xref="GOA:D3F422"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:D3F422"
FT                   /inference="protein motif:TFAM:TIGR00328"
FT                   /protein_id="ADB48505.1"
FT                   /translation="MADDRTERATPRKRDDARRRGQVARSMDVNGAVVLIAGLFALSLL
FT                   GPAVVGAMETSMRDSFERISDPQAALTAGGLEGIAMSTLRTLALAIGPVAAVCAIAGIV
FT                   ANLGQVGLKPSAEALKPQAQRINPLSGARNVFGPRMFFEGAKSIVKVAVIGVIVAMAVA
FT                   PKMTELSATVGASPGQLAAELVSLVLSISQRAAIAYLVIGAIDYAYQKYTHEKQLRMSM
FT                   QDVKDEFRSQQLPAEVKSMQRRRMMQQARARMMSAVPDADVVVTNPTHFAVALKYDGTK
FT                   PAPIVVAKGQDLIALQIRRLAAEHDVPVIENRPLARSLHATVEVGQMIPEDLYQAVAQV
FT                   LAHVYRVAGNARRKVGAR"
     atggccgacg acagaacaga gagagcgaca cccagaaagc gcgacgacgc ccgcagaaga        60
     ggccaggtcg cgcgctcgat ggacgtcaac ggcgcggtcg tgctgatcgc cggcctgttc       120
     gcgctgagcc tgctcggccc cgccgtcgtc ggcgcgatgg agacgtcgat gcgcgactcg       180
     ttcgagcgca tctccgaccc gcaggccgcg ctgaccgcgg gcgggctgga ggggatcgcg       240
     atgtcgacgc tgcggacgct cgcgctcgcg atcggcccgg tcgccgccgt ctgcgcgatc       300
     gccggcatcg tcgccaacct cggccaggtc ggcctcaaac cgtcggcgga ggcgctcaag       360
     ccgcaggcgc agcggatcaa cccgctcagc ggcgcgagaa acgtcttcgg cccgcggatg       420
     ttcttcgagg gtgcgaagtc gatcgtcaag gtcgccgtca tcggcgtgat cgtcgcgatg       480
     gcggtcgcgc cgaagatgac cgagctgtcg gcgaccgtcg gcgcgagccc cggccagctc       540
     gcggccgagc tggtgagcct cgtgctgtcg atctcgcagc gcgcggcgat cgcctacctc       600
     gtgatcggcg cgatcgacta cgcctaccag aagtacacgc acgagaagca gctgcggatg       660
     tccatgcagg acgtcaagga cgagttcaga tcgcagcagc tgccggccga ggtcaagtcg       720
     atgcagcgac gccggatgat gcagcaggcg cgcgctcgca tgatgtccgc ggttcccgac       780
     gctgacgtcg tcgtcacgaa cccgacgcac ttcgccgtcg cgctcaagta cgacggcacc       840
     aagcccgcgc cgatcgtcgt cgccaagggg caggacctga tcgcgctgca gatccgcaga       900
     ctggccgccg agcacgacgt gccggtgatc gagaacagac cgctcgcgcg ctcgctgcac       960
     gcgaccgtcg aggtcggcca gatgatcccc gaggacctct accaggccgt cgcgcaggtc      1020
     ctggcccacg tgtacagagt cgcggggaac gcccgcagga aggtcggcgc gcgatga         1077
//

If you have problems or comments...

PBIL Back to PBIL home page