(data stored in ACNUC7421 zone)

EMBL: CP001854.PE7

CP001854.PE7         Location/Qualifiers
FT   CDS_pept        complement(9739..10227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0007"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48443"
FT                   /db_xref="GOA:D3EYR0"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYR0"
FT                   /inference="protein motif:PFAM:PF01844"
FT                   /protein_id="ADB48443.1"
FT                   /translation="MLVLNATFEPINVCSVRRAVVLLLKAKAEMLEHGEYHLHSGSSTV
FT                   PRPMVIRLVSYVRVPRDTHRRKITRRAVFARDDWTCQYCGSRGNLTVDHVIPRSKGGGS
FT                   TWDNIVASCAPCNRRKGDSLPNQAGMVPKSTPRTPGPNVFIQVASPTIPRAWQQYLAF"
     gtgctcgtcc tcaatgcgac cttcgagccg atcaacgtct gctcggtccg gcgcgccgtc        60
     gtcctgctgc tgaaggcgaa ggcggagatg ctggagcacg gcgagtacca cctgcactcc       120
     ggcagctcga cggtgccgag gccgatggtg atccgcctcg tcagctacgt ccgcgtcccg       180
     cgcgacacgc accgtcgcaa gatcacccgt agggcggtct tcgcccgcga cgactggacc       240
     tgccagtact gcggctcgcg cggcaacctg accgtcgacc acgtgatccc ccgctcgaag       300
     ggcggcggat cgacgtggga caacatcgtc gcctcgtgcg cgccgtgcaa tcgccgcaag       360
     ggcgactcgc tgcccaacca ggccggcatg gtgccgaaat cgacgccgcg caccccgggc       420
     ccgaacgtct tcatccaggt cgccagcccg acgatcccgc gcgcctggca gcagtacctg       480
     gccttctag                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page