(data stored in ACNUC7421 zone)

EMBL: CP001854.PE70

CP001854.PE70        Location/Qualifiers
FT   CDS_pept        64321..66399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0070"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /note="TIGRFAM: flagellar biosynthesis protein FlhA; PFAM:
FT                   type III secretion FHIPEP protein; KEGG: dal:Dalk_1003
FT                   flagellar biosynthesis protein FlhA"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48506"
FT                   /db_xref="GOA:D3F423"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:D3F423"
FT                   /inference="protein motif:TFAM:TIGR01398"
FT                   /protein_id="ADB48506.1"
FT                   /translation="MNSPLLRKALGQTDLLAALGVVLIVVMLVIPLPPMLLDFFITLNI
FT                   SAAIAIVVATLYLNRALDFSAFPSLLLLTTMFRLAINVSVTRLILTTGDAGHVIRAFGE
FT                   FVVGGNVIVGLVIFFILVVIQFVVVTNGASRVAEVGARFTLDAMPGKQMAIDADLNAGL
FT                   ITDDEARRRRAEISQEADFYGSMDGASKFVRGDAIAAIVIVLINLLGGLAVGIMQMDMP
FT                   FGEAIQHFSLLTIGDGLAAQIPALLISVATGILVTRAASDRDLGADISDQILKQRKAPL
FT                   VAGGAILAFALVPGLPKIPFIVIGGIFLAVGLALRRADADQAEEDAETARIDAEGTAAA
FT                   QPRDAALEALPIDPLELAIGFGLVRLVDQQNGGTLLSRVSVIRRQIATELGMVIPPVRI
FT                   HDELGLDSHEYVLKVRGTEVARGRIMAGHQLAMDPGDAVGQLQGVPTTEPAFGLPATWV
FT                   TDDQRAEAEALGFTVVDGESVIVTHLTETIRAHASELLTRQDVRALLDQLKESNQAVVD
FT                   EVVPDMLTLGEIQRVLQGLLSEGVSIRDLGTIVEAIGDKARLTRDPALLAEYARQALGR
FT                   TITAPYLDGEQRLRALALDPAIEQEVAASITQTSDGEYLAMDPVRAQALIGALRTQVEH
FT                   ATARGSRPVLLCSARVRRHIRRLVEQALPHLAVCSYNEIAPGITVETIGVIEHELAS"
     atgaactccc cgctgctgag aaaggctctc ggccagaccg acctgctggc ggcgctcggc        60
     gtcgtgctga tcgtggtgat gctcgtcatc ccgctgccgc cgatgctgct cgacttcttc       120
     atcacgctga acatctcggc ggcgatcgcg atcgtggtgg cgacgctcta cctcaaccgc       180
     gcgctcgact tctccgcgtt cccgtcgctg ctgctcctga cgacgatgtt ccggctcgcg       240
     atcaacgtct cggtcacgcg cctgatcctc acgaccggcg acgccggcca cgtcatcaga       300
     gcgttcggcg agttcgtcgt cggcggcaac gtgatcgtcg gcctcgtgat cttcttcatc       360
     ctcgtcgtga tccagttcgt cgtcgttacg aacggcgcca gccgcgtcgc cgaggtcggc       420
     gcgcgcttca cgctcgacgc gatgcccggc aagcagatgg cgatcgacgc cgacctcaac       480
     gctggcctga tcactgacga cgaggcgcgc agacgccgcg ccgagatctc gcaggaggcc       540
     gacttctacg gctcgatgga cggcgcctcg aagttcgtca gaggcgacgc gatagcggcg       600
     atcgtgatcg tgctgatcaa cctgctcggc ggtctcgccg tcgggatcat gcagatggac       660
     atgccgttcg gcgaggcgat ccagcacttc tcgctgctga cgatcggcga cggcctcgcg       720
     gcgcagatcc cggcgctgct gatctcggtc gcgaccggca tcctcgtcac gcgcgcggcg       780
     tccgacagag acctcggcgc cgacatctcc gaccagatcc tcaagcagcg caaggcaccg       840
     ctcgtcgccg gcggcgcgat cctcgcgttc gcgctcgtgc cgggcctgcc gaagatcccg       900
     ttcatcgtga tcggcggcat cttcctcgcg gtcgggctgg cgctgcgcag agcggacgcc       960
     gaccaggccg aggaggacgc cgagacggcg cgcatcgacg ccgagggcac cgccgccgcg      1020
     cagccgcgcg acgcggcgct ggaggcgctg ccgatcgacc cgctcgagct cgcgatcggc      1080
     ttcggcctcg tgcggctcgt cgaccagcag aacggcggca cgctgctctc gcgcgtgagc      1140
     gtcatccggc ggcagatcgc gaccgagctg gggatggtga tcccgcccgt gcggatccac      1200
     gacgagctgg ggctcgactc gcacgagtac gtgctgaagg tgcgcggaac cgaggtcgcg      1260
     cgcgggcgga tcatggccgg ccaccagctc gcgatggacc cgggcgacgc ggtcggccag      1320
     ctgcagggcg tgccgacgac cgagccggcg ttcggcctgc ccgcgacgtg ggtcaccgac      1380
     gaccagcgcg cggaggcgga ggcactcggc ttcaccgtcg tcgacggcga gtcggtgatc      1440
     gtcacgcacc tgaccgagac gatccgcgcg cacgcctctg agctgctcac ccgccaggac      1500
     gtgagagcgc tgctggacca gctgaaggag agcaaccagg cggtcgtcga cgaggtcgtg      1560
     ccggacatgc tcacgcttgg cgagatccag cgcgtgctgc aggggctgct gtcggagggc      1620
     gtctcgattc gcgacctcgg cacgatcgtc gaggcgatcg gcgacaaggc gcggctcacg      1680
     cgcgacccgg cgctgctggc cgagtacgcg cgccaggcgc tcggccgcac gatcaccgcg      1740
     ccgtacctcg acggcgagca gcggctgcgc gcgctcgcgc tcgacccggc gatcgagcag      1800
     gaggtcgcgg cgtcgatcac gcagacctcc gacggcgaat acctcgcgat ggatcccgtc      1860
     cgcgcgcagg ctttgatcgg cgcgctccga acacaggtgg agcacgcgac cgcgcgcggc      1920
     agcaggccgg tgctgctgtg ctcggcgcgc gtgcgccgcc acatccggcg gctcgtcgag      1980
     caggcgctgc cgcacctcgc ggtctgctcg tacaacgaga tcgcacccgg catcactgtg      2040
     gagacgattg gagtgatcga gcatgagctc gcaagttga                             2079
//

If you have problems or comments...

PBIL Back to PBIL home page