(data stored in ACNUC7421 zone)

EMBL: CP001854.PE71

CP001854.PE71        Location/Qualifiers
FT   CDS_pept        66383..68515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0071"
FT                   /product="GTP-binding signal recognition particle SRP54
FT                   G-domain protein"
FT                   /note="PFAM: GTP-binding signal recognition particle SRP54
FT                   G- domain; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48507"
FT                   /db_xref="GOA:D3F424"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR020006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3F424"
FT                   /inference="protein motif:PFAM:PF00448"
FT                   /protein_id="ADB48507.1"
FT                   /translation="MSSQVDDRPKTNGHVPADPSLRTYRGRSLEEILPQIRAELGPDAV
FT                   VVRQRDGLMGGIGGFFQQQFVEVQARAGGGKMRLDVYDDEPALPEPLQQAAAEEPAPPS
FT                   SPAAFEAPRPVGPPASSGPESLAPAPRAGPTAAELLAQATGSAAGDPRTPAEILRAHSG
FT                   TFAKQLADAEERAEPTVRASGAASAAADEPTGRYAPPVPADAAETEPIPLPPRPAPAPV
FT                   PAPEPELPPAARAAPVAPAAPARPARATARRAAAKKRRGAAKGRARAAPAARAPAPRAE
FT                   PAARVPAASAEPATATAAPAARAAPVARTEPVARVPTPEAAPAPRAAPSVRAEPAPRAA
FT                   TSKPRAKPAKPAAAAKPESPASGVGPRTTQALELAAAIAAANLAARAAASALPAPARPP
FT                   VEAAEPAPAQPGTAGPGTELVLATAPSPAPPAASPRVTAPRRSLFGRRSGATTPRRLVD
FT                   APAAAEVTGSLAAHGLAPAAAEELLVDATAHVLPFTPGADVRTAVRSALARRIPLPAPP
FT                   RLGGRVVAFVGAGGGGKTRCTAGLAAAYAQGSSVPVACLTFAPADGGAELTALLKPHGV
FT                   KVEAVATAEAAAKRLAALRAEALVVLDTPAVSPGDPDAVARMAAELAPLQLDEIQLVVP
FT                   ATLSATVAEELVERLAPLQPTGIAMTHADATDHIGAVVDLACATRLPLAYVNSGLELPG
FT                   ALAPADPAQLAERLLS"
     atgagctcgc aagttgacga tcgaccgaag acgaacgggc acgtgccggc cgacccctcg        60
     ctgcgcacct accgcggcag atcgctggag gagatcctcc cgcagatccg cgccgagctc       120
     ggtcccgacg ccgtcgtcgt gcgtcagcgc gacgggctga tgggcggcat cggcggcttc       180
     ttccagcagc agttcgtcga ggtccaggcg cgggcgggcg ggggcaagat gcggctggac       240
     gtctacgacg acgagcccgc actgcccgag ccgctccagc aggccgccgc cgaggagccg       300
     gcgccacctt cgtctccggc ggccttcgag gctccccgcc ctgtgggtcc gccggcctcg       360
     tccggtcccg agtcgctcgc gccggcgccg agagcggggc cgaccgccgc cgagctgctc       420
     gcgcaggcga ccggctccgc ggccggcgac ccgcgcacgc ccgcggagat cctgcgcgcc       480
     cacagcggta cgttcgccaa gcagctcgcc gacgccgagg agcgtgccga gccgaccgtc       540
     cgcgcgagcg gcgccgcgtc ggcggccgcc gacgagccga ccggccgcta cgccccgccc       600
     gtccccgccg acgcggccga gacggagccg atcccgctcc cgccccgccc ggcccccgca       660
     cccgtgccgg cccccgagcc cgagctgccg cccgcggcga gagctgcgcc cgtcgccccg       720
     gctgcgcccg cccggccggc gagagccaca gcgagaagag ctgcggcgaa gaagcgcaga       780
     ggcgcggcga aggggagagc gagagccgct ccggccgcga gagcccccgc tccgagagcg       840
     gagccggccg cgagagtgcc cgccgcgagc gcggagccgg ccaccgccac cgccgctcca       900
     gccgcaagag ccgcgccggt cgccagaacg gaaccggtcg cgagagtccc cacaccggaa       960
     gccgctccgg ctcccagagc cgcgccctcc gtgagagcgg agccagcccc gagagccgcc      1020
     acctcgaagc cgcgcgcgaa gccggccaag cccgcagcgg ccgcaaagcc ggagtcgccc      1080
     gcgagcggcg tcggcccgcg cacgacccag gcgctggagc tggccgcggc gatcgcggcg      1140
     gccaatctcg cagccagggc ggccgcctcc gcgctcccgg cgcccgcccg gcccccggtg      1200
     gaggccgccg agccggcgcc cgcgcagccg ggcacggccg gtcccggcac cgagctggtc      1260
     ctcgccaccg cgccctcgcc agcgcctccg gccgcgtcac cgcgtgtcac cgccccccgt      1320
     cgcagcctct tcggccgccg cagcggcgcg acgacgccgc gccggctcgt cgacgcgccg      1380
     gccgcggcgg aggtgacagg ctcgctcgcc gcgcacggtc tcgcgccggc cgcggcggag      1440
     gagctgctcg tcgacgcgac cgcgcacgtg ctgccgttca ctccgggcgc cgatgtcaga      1500
     acggcggtcc gctccgcact cgcgcgccgc atcccgctgc ccgccccgcc ccgcctcggc      1560
     ggccgcgtcg tcgcgttcgt cggcgccggc ggcggtggca agacgcgctg caccgccggg      1620
     ctcgccgccg cgtacgcgca gggcagctcc gtcccggtcg cctgcctcac gttcgccccg      1680
     gccgatggcg gcgccgagct gaccgcgctg ctcaagcccc acggcgtcaa ggtcgaggcg      1740
     gtcgcgacgg cggaggccgc cgccaagcgg ctcgccgcgc tccgcgccga ggcgctcgtc      1800
     gtgctcgaca cgcccgctgt ctccccgggc gaccccgacg cggtcgcgcg gatggcagcc      1860
     gagctggcac cgctccagct cgacgagatc cagctcgtcg taccggcgac gctcagcgcg      1920
     accgtcgcgg aagagctggt cgagcggctc gcgccgctgc agccgaccgg gatcgcgatg      1980
     acccacgccg acgcgaccga ccacatcggc gccgtcgtcg acctcgcctg cgcgacgcga      2040
     ctcccgctcg cctacgtcaa cagcgggctg gagctgccgg gcgcgctcgc gccggccgac      2100
     ccggcccagc tcgcggagcg gctgctgtca tga                                   2133
//

If you have problems or comments...

PBIL Back to PBIL home page