(data stored in ACNUC7421 zone)

EMBL: CP001854.PE72

CP001854.PE72        Location/Qualifiers
FT   CDS_pept        68598..69269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0072"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48508"
FT                   /db_xref="UniProtKB/TrEMBL:D3F425"
FT                   /inference="protein motif:PFAM:PF07238"
FT                   /protein_id="ADB48508.1"
FT                   /translation="MSPLRKRPQRRPGSAAPPPLPEVRQEVDLALPGRERFAARVTQVS
FT                   DEAIVLVLMLDARDPLQLGEVAEMALEFAGPRGLVRIEGQGRVTAYDVVHLRLEGAVEV
FT                   VQRRDFVRVRAVRPMALAPIDEEGTIGDWIDTLTVNVSGNGFLAAGPDTLAIGSAVRFR
FT                   VRVVEGEPPIEGLGRVARASDAGHRGIAIEQLVDDGRRRLVAFIFERERIARRVTRDSE
FT                   L"
     atgagcccgc tgcgcaagcg gccgcagcgg cggccgggct ccgccgcgcc gccgccgttg        60
     ccggaggtgc gtcaggaggt cgacctggcg ctgcccgggc gcgagcgctt cgcggcgcgc       120
     gtgacgcagg tctccgacga ggcgatcgtg ctcgtgctga tgctcgacgc gcgtgacccg       180
     ctgcagctcg gcgaggtcgc cgagatggcg ctcgagttcg ccggcccgcg cgggctcgtg       240
     cggatcgagg gccaggggcg ggtgacggcg tacgacgtcg tccacctgcg actggagggc       300
     gcggtcgagg tcgtccagcg gcgtgacttc gtgcgcgtca gagcggtgcg gccgatggcg       360
     ctggcgccga tcgacgagga gggcacgatc ggcgattgga tcgacacgct gacggtcaac       420
     gtcagcggca acggcttcct cgcggccggc cccgacacgc tcgcgatcgg gagcgcggtg       480
     cgcttccgcg ttcgcgtcgt cgagggcgag ccgccgatcg agggtctcgg tcgcgtcgcg       540
     cgcgccagcg acgccggcca ccgcgggatt gcgatcgagc agctggtcga cgacggccgc       600
     cggcgcttgg tcgccttcat cttcgaacgc gagcggatcg cgcgcagagt cacgcgcgac       660
     agcgagctgt ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page