(data stored in ACNUC7421 zone)

EMBL: CP001854.PE73

CP001854.PE73        Location/Qualifiers
FT   CDS_pept        69287..69694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: DNJ19; DnaJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48509"
FT                   /db_xref="GOA:D3F426"
FT                   /db_xref="UniProtKB/TrEMBL:D3F426"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48509.1"
FT                   /translation="MAPRDTRARGRQRGARGGGAGRGRRRGSGGGGPTLPSVANHPKAG
FT                   EQVKRAKAWAGLVGFGLVAFVSWRGGVPVEDLLLRSLAGGIIAYLVVWACAVAIWRHLV
FT                   VTELEVVRERRAEEAAARKAAAPPMTDGAEA"
     atggcaccga gggacacgcg cgcgcgtggg cgccagagag gcgcgcgcgg gggcggcgcg        60
     ggcagaggcc ggcgcagagg cagcggcggc ggtgggccga cgctgccgag cgtcgccaac       120
     catccgaagg cgggcgagca ggtcaagcgg gcgaaggcgt gggccggcct ggtcggcttc       180
     ggcctcgtcg cgttcgtctc ctggcgaggc ggcgtgccgg tcgaggacct gctgctgcgc       240
     tcgctcgccg gcgggatcat cgcctacctc gtcgtctggg cgtgcgccgt cgcgatctgg       300
     cgccacctcg tcgtgaccga gctggaggtc gtgcgcgagc gccgcgccga ggaggccgcc       360
     gcgcgcaagg ctgccgcgcc gccgatgacc gacggcgccg aggcgtag                    408
//

If you have problems or comments...

PBIL Back to PBIL home page