(data stored in ACNUC7421 zone)

EMBL: CP001854.PE74

CP001854.PE74        Location/Qualifiers
FT   CDS_pept        69708..69950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0074"
FT                   /product="melanoma antigen family E, 1-like protein"
FT                   /note="KEGG: similar to melanoma antigen family E, 1"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48510"
FT                   /db_xref="UniProtKB/TrEMBL:D3F427"
FT                   /inference="similar to AA sequence:KEGG:100021553"
FT                   /protein_id="ADB48510.1"
FT                   /translation="MVDRINPIIPRNPDIFPVPSVGRPRVSEQERDQRRREREDDEREQ
FT                   EQERRRAAAAARRAADAAAADAGEDDERPHVDLIA"
     atggtcgatc ggatcaaccc gatcatcccg cgcaaccccg acatcttccc ggtgccgtcc        60
     gtcggccggc cgcgggtctc cgagcaggag cgggaccagc gccgcaggga gcgcgaggac       120
     gacgagcgcg agcaggagca ggagcgccgc cgcgccgccg ccgctgcaag acgcgccgcc       180
     gacgctgccg ccgcagacgc gggcgaggac gatgagcgcc cgcacgtcga cctgatcgcc       240
     tag                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page