(data stored in ACNUC7421 zone)

EMBL: CP001854.PE75

CP001854.PE75        Location/Qualifiers
FT   CDS_pept        70083..70874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0075"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: gsu:GSU3038
FT                   flagellin FliC"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48511"
FT                   /db_xref="GOA:D3F428"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:D3F428"
FT                   /inference="protein motif:PFAM:PF00700"
FT                   /protein_id="ADB48511.1"
FT                   /translation="MSLRINTNVEAFNAHRNLESTSGKLAKSMERLSSGFRINRAADDA
FT                   AGLAISEKLRGQIGGLNQARRNVQDGISLVQTAEGSLTEVHSMLQRVRELAVQHATGTL
FT                   ATTDRGAIMSEVAQLAAEIDRIGTTAQFNGIRLLDGSAASITFQVGANDSETISVATVR
FT                   LSDAVRGMRADAALRDIDTAIANVSDARAVFGAVQNRLEHTYNNLSVYQENLTASESRI
FT                   RDVDMAAEMVNFTKNNILQQAGTSMLAQAQQAPQSVLSLLR"
     atgtcccttc gtatcaatac gaacgtcgag gcgttcaacg cgcaccgcaa tctcgagagc        60
     accagcggca agctcgcgaa gtcgatggag cgcctgtcct cgggcttccg gatcaatcgt       120
     gctgctgacg atgccgcggg tctcgcgatc tcggagaagc tgcgcggtca gatcggcggc       180
     ctgaaccagg cgcgtcggaa cgtgcaggac ggcatctccc tcgtccagac ggcggaaggt       240
     tcgctgaccg aggttcacag catgcttcag cgtgtccgcg agctcgcggt ccagcacgcc       300
     accggcacgc tcgcgacgac ggacagaggc gcgatcatgt ccgaggtcgc gcagctcgcc       360
     gctgagatcg accgcatcgg cacgacggca cagttcaacg gcatcagact gctcgacggc       420
     agcgccgctt cgatcacgtt ccaggtcggc gccaacgact cggagacgat ctccgtcgcg       480
     acggtcagac tctctgacgc agtcagaggc atgagagccg acgcggcgct cagagacatc       540
     gataccgcga tcgcgaacgt gtcggatgcg cgtgcggtgt tcggtgcggt gcagaatcgt       600
     ctggagcaca cgtacaacaa cctgtccgtg taccaggaga atctgactgc gtctgagtcg       660
     cgtatccgtg acgtggacat ggctgcggag atggtgaact tcaccaagaa caacatcctg       720
     cagcaggccg gcacgagcat gctcgcgcag gcccagcagg ccccgcagtc cgtcctctcg       780
     ctcctgcgct ag                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page