(data stored in ACNUC7421 zone)

EMBL: CP001854.PE76

CP001854.PE76        Location/Qualifiers
FT   CDS_pept        70967..71764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0076"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: gsu:GSU3038
FT                   flagellin FliC"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48512"
FT                   /db_xref="GOA:D3F429"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:D3F429"
FT                   /inference="protein motif:PFAM:PF00700"
FT                   /protein_id="ADB48512.1"
FT                   /translation="MSLRINTNVEAFNAHRNLEGTSSKLAKSMERLSSGFRINRAADDA
FT                   AGLAISEKLRGQIGGLNQARRNVQDGISLVQTAEGSLTEVHSMLQRVRELAVQHATGTL
FT                   AGTDRAAIVSEVTQLTDEIRRISNTAQFNKIDLLRADATIDFQVGANDRETISVATIAL
FT                   SRAVPATLDITARTALADIDRAIGAVSDQRAVFGAVQNRLEHTYNNLSVYQENLTASES
FT                   RIRDVDMAAEMVNFTKNNILQQAGTSMLAQAQQAPQSVLSLLR"
     atgtcccttc gtatcaacac gaacgtggaa gcgttcaacg cgcatcgcaa tctcgagggc        60
     acgagcagca agctggcgaa gtcgatggag cgcctgtcgt cgggctttcg catcaaccgt       120
     gctgctgacg acgccgctgg ccttgcgatt tcggagaagc tgcgtggtca gatcggcggt       180
     ctgaaccagg ctcgtcgtaa cgtgcaggac ggtatttcgc tggtgcagac ggcggaaggt       240
     tcgctgaccg aggttcacag catgcttcag cgtgtccgcg agctcgcggt ccagcacgcc       300
     accggcacgc tggcggggac ggacagagcc gcgatcgtct ccgaggtcac gcagctgacc       360
     gacgagatca gacgcatcag caacactgcg cagttcaaca agatcgacct gctcagagcg       420
     gatgcgacga tcgacttcca ggtcggcgcc aacgacagag agacgatctc ggtcgcgacg       480
     atcgcgctca gcagagcggt ccccgcaacg ctcgacatca cggccagaac ggcgcttgcc       540
     gacatcgaca gagcgatcgg cgcggtgtcg gatcagcgtg cggtgttcgg tgcggtgcag       600
     aatcgtctgg agcacacgta caacaatctg tcggtgtacc aggagaatct gactgcgtct       660
     gagtcgcgta tccgtgacgt ggacatggct gcggagatgg tgaacttcac caagaacaac       720
     atcctgcagc aggccggcac ttcgatgctg gcgcaggcgc agcaggcgcc gcagtccgtc       780
     ctctcgctcc tgcgctag                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page