(data stored in ACNUC7421 zone)

EMBL: CP001854.PE77

CP001854.PE77        Location/Qualifiers
FT   CDS_pept        71855..72655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0077"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: gsu:GSU3038
FT                   flagellin FliC"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48513"
FT                   /db_xref="GOA:D3F430"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:D3F430"
FT                   /inference="protein motif:PFAM:PF00700"
FT                   /protein_id="ADB48513.1"
FT                   /translation="MSLRINTNVEAFNAHRNLEGTSSKLAKSMERLSSGFRINRAADDA
FT                   AGLAISEKLRGQIGGLNQARRNVQDGISLVQTAEGSLTEVHSMLQRVRELKVQHATGTL
FT                   ATTDRDAIVSEVRQLTAEIDRIGDTAQFNGIRLLDARTTISFQVGANDTEMISVDTFAL
FT                   RTAVDTGRLATLGTATLSEIDRAIGAVSDQRAVFGAVQNRLEHTYNNLSVYQENLTASE
FT                   SRIRDVDMAAEMVNFTKNNILQQAGTSMLAQAQQAPQSVLSLLR"
     atgtcccttc gtatcaacac gaacgtcgag gcgttcaacg cgcatcgcaa tctcgagggc        60
     acgagcagca agctggcgaa gtcgatggag cgcctgtcgt cgggctttcg catcaaccgt       120
     gctgctgacg acgctgccgg ccttgcgatt tcggagaagc tgcgtggtca gatcggcggt       180
     ctgaaccagg ctcgccgtaa cgtgcaggac ggtatttcgc tggtgcagac ggcggaaggt       240
     tcgctgaccg aggttcacag catgcttcag cgcgtccgcg agctgaaggt ccagcacgcc       300
     accggcacgc tcgcgacgac agacagagac gcgatcgtct ccgaggtgag acagctgacg       360
     gccgagatcg accgcatcgg cgacacggcg cagttcaacg gcatcagact gctcgacgcc       420
     agaacgacga tctcgttcca ggtcggcgcc aacgacaccg agatgatctc ggtcgacaca       480
     ttcgccctga gaacagccgt cgacacgggg agactcgcca cgctcgggac cgcgacgctg       540
     tccgagatcg acagagcgat cggcgcggtg tcggatcagc gtgcggtgtt cggtgcggtg       600
     cagaatcgtc tggagcacac gtacaacaat ctgtcggtgt accaggagaa tctgactgcg       660
     tctgagtcgc gtatccgtga cgtggacatg gctgcggaga tggtgaactt caccaagaac       720
     aacatcctgc agcaggccgg cacgagcatg ctcgcgcagg cccagcaggc gccgcagtcc       780
     gtcctctcgc tgctccgcta g                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page