(data stored in ACNUC7421 zone)

EMBL: CP001854.PE78

CP001854.PE78        Location/Qualifiers
FT   CDS_pept        72889..73680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0078"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: gsu:GSU3038
FT                   flagellin FliC"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48514"
FT                   /db_xref="GOA:D3F431"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:D3F431"
FT                   /inference="protein motif:PFAM:PF00700"
FT                   /protein_id="ADB48514.1"
FT                   /translation="MSLRINTNVEAFNAHRNLEGTSSKLAKSMERLSSGFRINRAADDA
FT                   AGLAISEKLRGQIGGLNQARRNVQDGISLVQTAEGSLTEVHSMLQRVRELAVQHATGTL
FT                   AREDRGAIASEIAQLTQEVERIGTTSQFNGITLLDGRNATVAFQVGANDGETISVATVS
FT                   LQARVGRLDQTSTLAQIDTAIANVSDARAVFGAVQNRLEHTYNNLSVYQENLTASESRI
FT                   RDVDMAAEMVNFTKNNILQQAGTSMLAQAQQAPQSVLSLLR"
     atgtcccttc gtatcaacac gaacgtggaa gcgttcaacg cgcatcgcaa tctcgagggc        60
     acgagcagca agctcgcgaa gtcgatggag cgcctctcgt cgggcttccg gatcaaccgt       120
     gctgctgacg atgccgcggg tctcgcgatt tcggagaagc tgcgtggtca gatcggcggt       180
     ctgaaccagg cgcgccgcaa cgtgcaggac ggcatctccc tcgtccagac ggcggaaggt       240
     tcgctgaccg aggttcacag catgcttcag cgtgtccgcg agctcgcggt ccagcacgcc       300
     accggcacgc tcgcgagaga ggacagaggc gcgattgcat cagagatcgc gcagctgacg       360
     caggaggtcg agcggatcgg cacgacatcg cagtttaacg ggatcacgct gctcgacggc       420
     agaaacgcga cggtcgcgtt ccaggtcggc gccaacgacg gcgagacgat ctcggtcgcg       480
     acggtctcgc tccaagcgag agtcggcaga ctcgaccaga cttcgacgct tgctcagatc       540
     gacacggcga tcgcgaacgt gtcggatgcg cgtgcggtgt tcggtgcggt gcagaatcgt       600
     ctggagcaca cgtacaacaa tctgtcggtg taccaggaga atctgactgc gtctgagtcg       660
     cgtatccgtg acgtggacat ggctgcggag atggtgaact tcaccaagaa caacatcctg       720
     cagcaggccg gcacgagcat gctcgcgcag gcccagcagg cgccgcagtc cgtcctctcg       780
     ctgctccgct ag                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page