(data stored in ACNUC7421 zone)

EMBL: CP001854.PE79

CP001854.PE79        Location/Qualifiers
FT   CDS_pept        73760..74446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0079"
FT                   /product="CHAP domain containing protein"
FT                   /note="PFAM: CHAP domain containing protein; KEGG:
FT                   bam:Bamb_5483 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48515"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D3F432"
FT                   /inference="protein motif:PFAM:PF05257"
FT                   /protein_id="ADB48515.1"
FT                   /translation="MSLAAAIARIDEIQSAFTPRVPPTQSFNGGAAAPSAVTASASSAN
FT                   AFSNVLNGALSNTGVVTPGTAGAPGLYAPGGVLTNGGAGAGAPAMVALAQGEVGQAEFP
FT                   PGSNDSPRIATYRESTAGSGVGPWCAYFTSWLADQAGAPLGDSGQGFGRVDDVYAWAQR
FT                   TGRAVPNGPGAVPQPGDLIVWDEHIGMVEQVLPDGRIQTIEGNSSDQVKRNVHEAGSAL
FT                   GYVRMS"
     atgtccctcg cagcagcaat cgcgcggatc gacgagatcc agagcgcctt cacgccgcgg        60
     gtcccgccga cgcagtcctt caacggcggt gcagccgcac cgtctgccgt cacggccagc       120
     gcgtcgtccg cgaacgcctt ctcgaacgtg ctcaacggcg cgctctcgaa cacgggcgtc       180
     gtgaccccgg gcacggccgg cgcgcccggc ctctacgcgc ccggcggcgt gctgaccaac       240
     ggcggcgccg gtgccggcgc gcccgcgatg gtcgcgctcg cgcagggcga ggtcggccag       300
     gccgagttcc cgcccggctc caacgactcg ccgcggatcg ccacctaccg cgagtcgacc       360
     gccggcagcg gcgtcggccc gtggtgcgcc tacttcacct cgtggctcgc cgaccaggcc       420
     ggcgcaccgc tcggcgacag cgggcagggc ttcggccgcg tcgacgacgt ctacgcgtgg       480
     gcgcagcgga ccggccgcgc cgtgccgaac ggccccggcg ccgtgccgca gccgggcgac       540
     ctgatcgtct gggacgagca catcggcatg gtcgagcagg tgctgccgga cggccgcatc       600
     cagacgatcg agggtaactc ctctgatcag gtgaagcgca acgtccacga ggccgggtcg       660
     gcgctcggct acgtgaggat gagctag                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page