(data stored in ACNUC7421 zone)

EMBL: CP001854.PE8

CP001854.PE8         Location/Qualifiers
FT   CDS_pept        complement(10401..11240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0008"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; KEGG: ade:Adeh_1779 prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48444"
FT                   /db_xref="GOA:D3EYR1"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYR1"
FT                   /inference="protein motif:PRIAM:4.2.1.51"
FT                   /protein_id="ADB48444.1"
FT                   /translation="MRVGYLGPEGTNSHEALLAALGGEQHEQVPLPTIYDCVVAVQELE
FT                   VDRAFVPIENAIEGSVNAVLDALAVDAEQVRIVGEAIHPIHTCLIAPAPIELSAIETVL
FT                   SHPQANGQCAHFLRTRLPQARVLAASSTAEAVRAVAEGDAGPNAAALGSRLAAEQYGCE
FT                   ILRAGVDDVAGNETRFVWLAPEGTSAGEHGPWKTAIVFWGVGAEAPGWLVRCLSEFAFR
FT                   GVNLTRIESRPRKQGLGRYMFFLDLEGSEEEGPVAEALTALRGHTEHLRVLGSFPAA"
     atgcgcgtcg gctatctcgg cccggagggc acgaactccc acgaggcgct gctggccgcg        60
     ctcggcggcg agcagcacga gcaggtgccg ctgccgacga tctacgactg cgtcgtcgcg       120
     gtgcaggagc tggaggtcga ccgcgccttc gtgccgatcg agaacgcgat cgaggggtcg       180
     gtcaacgcgg tgctcgacgc gctcgcggtc gacgccgagc aggtgcggat cgtcggcgag       240
     gcgatccatc cgatccacac gtgcctgatc gcaccggcgc cgatcgagct gagcgcgatc       300
     gagacggtcc tctcgcaccc gcaggccaac ggccagtgcg cgcacttcct gcgcacgcgg       360
     ctgccgcagg cgcgggtgct ggcggccagc tccacggccg aggcggtgcg cgcggtcgcc       420
     gagggcgacg ccggccccaa cgccgcggcg ctcggcagcc gcctcgccgc cgagcagtac       480
     ggctgcgaga tcctgcgcgc gggcgtcgac gacgtcgccg gcaacgagac ccgcttcgtc       540
     tggctcgcgc ccgaggggac gtcggccggc gagcacgggc cgtggaagac ggcgatcgtc       600
     ttctggggcg tcggtgccga ggccccgggt tggctggtgc gctgcctgtc ggagttcgcc       660
     ttccgcggcg tcaacctgac gcggatcgag tcgcgcccgc gcaagcaggg cctcggccgc       720
     tacatgttct tcctcgacct cgagggaagc gaggaagaag ggcccgtcgc cgaggcgctg       780
     accgccctgc gggggcacac cgagcacctg cgcgtgctcg gatcgttccc ggccgcgtga       840
//

If you have problems or comments...

PBIL Back to PBIL home page