(data stored in ACNUC7421 zone)

EMBL: CP001854.PE80

CP001854.PE80        Location/Qualifiers
FT   CDS_pept        74518..75249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0080"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Sigma-70 region 4 type 2; SMART: regulatory
FT                   protein LuxR; response regulator receiver; KEGG:
FT                   mfa:Mfla_1714 two component LuxR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48516"
FT                   /db_xref="GOA:D3F433"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D3F433"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADB48516.1"
FT                   /translation="MTLFDEHDRGEAGARSGPDGLGEISVRRGPVTVVVVDPHAPVREG
FT                   LPPLLARDGIDVVATAATGDGAEAVIGHHAPDVALVALDLADVDGIVLLRRLAQRGSRS
FT                   AVVLYTDADDPQQSAVALHAGAAGVIAKRRSIAELSNALRAVAAGRLWFNEPGDLPMPP
FT                   RRLSPLLTDLRERRSSALSSAELRVLALVAEGSSTEEAAELLSLSPHTVRTHLRNVMRK
FT                   LEASSRAHAVAIAIRESAIKL"
     gtgacgctct tcgacgaaca cgaccgcgga gaggccggag cacgctccgg gccggacggc        60
     ctgggcgaga tctcggtgcg acgcggaccg gtgacggtcg tcgtcgtcga tccgcacgct       120
     cccgtgcgag aaggactgcc gccgctgctc gcgcgggacg gcatcgacgt cgtcgcgacc       180
     gccgcgaccg gggacggcgc ggaggcagtg atcggccatc acgcccccga cgtcgcgctc       240
     gtcgcgctcg acctcgccga cgtcgacggc atcgtgctgc tgcgtcgcct cgcccagcgc       300
     ggcagtcgca gcgccgtcgt cctctacacc gacgccgacg atccgcagca gtccgcggtc       360
     gcgctccacg ccggcgcggc cggcgtgatc gccaagcgcc gctcgatcgc cgagctgagc       420
     aacgccctgc gcgccgtcgc ggccgggcgc ctgtggttca acgagccggg agacctgccg       480
     atgccgcccc gccgtctctc cccgctcctg accgacctgc gggagcgccg ctcctccgcg       540
     ctgtcgagcg ccgagctgag ggtcctcgcg ctcgtcgccg aaggctcctc gaccgaggag       600
     gcggccgagc tgctgtcgct cagccctcac accgtccgca cacacctccg caacgtcatg       660
     cgcaagctgg aggcatccag ccgcgcccac gccgtcgcga tcgcgatccg cgagtccgcg       720
     atcaagctct ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page