(data stored in ACNUC7421 zone)

EMBL: CP001854.PE81

CP001854.PE81        Location/Qualifiers
FT   CDS_pept        complement(75239..76069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0081"
FT                   /product="Bacitracin resistance protein BacA"
FT                   /note="PFAM: Bacitracin resistance protein BacA; KEGG:
FT                   gsu:GSU0387 undecaprenol kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48517"
FT                   /db_xref="GOA:D3F434"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:D3F434"
FT                   /inference="protein motif:PFAM:PF02673"
FT                   /protein_id="ADB48517.1"
FT                   /translation="MSEQPAALPLRHALALGVLHGPAELLPISSSGHITLVPWLLRWPY
FT                   AELDPELRKAFEVALHAGTAAALLIGLRDEVGEAARGLDRRRIELIVLSFAPAGIAAFA
FT                   FERPIERRLGTPATIAAGLVLGSLAMALADRAPQERPREDAGWRDALALGLAQATALVP
FT                   GVSRNGATLAAARARGFTREDANALSRHVALPIIVAATVLKGTRLLRRGLPPQTRAAFA
FT                   IGTAASFASTLGSTWLIRQVERDRSLAPYAAYRFGLAGVVGWRLRRARAAALRA"
     ttgagcgagc agcccgcagc gctcccgctc cgccacgcgc tcgcgctcgg cgtgctgcac        60
     gggccggcgg agctgctgcc gatctcctcg tccggtcaca tcacgctcgt gccgtggctg       120
     ctgcgctggc cgtacgcgga gctcgacccg gagctgcgca aggcgttcga ggtcgcgctg       180
     cacgccggta ccgccgcggc gctgctgatc gggttgcgcg acgaggtcgg cgaggccgcg       240
     cgcgggctcg accgccgccg gatcgaactg atcgtgctct cgttcgcgcc cgccgggatc       300
     gccgcgttcg cgttcgagcg gccgatcgag cggcggctcg ggactcccgc gacgatcgcc       360
     gccgggctcg tgctcggctc gctcgcgatg gcgctcgccg accgcgcgcc gcaggagcgg       420
     ccgcgcgagg acgccggctg gcgcgacgcg ctcgcactcg gcctcgcgca ggcgaccgcg       480
     ctcgtgccgg gcgtctcgcg caacggcgcg acgctcgcgg cggcgcgagc gcgcggcttc       540
     acgcgcgagg acgcgaacgc gctctcccgc cacgtcgcgc tgccgatcat cgtcgccgcg       600
     accgtgctga agggcacgcg tctgctgaga cgcggcctcc cgccgcagac ccgcgccgcg       660
     ttcgcgatcg gcaccgccgc ctcgttcgcc tcgacgctcg gctcgacgtg gctgatccgc       720
     caggtcgagc gcgaccgctc gctcgctccc tacgcggcct accggttcgg cctcgccggc       780
     gtcgtcgggt ggcggctgcg gcgagcgcgc gccgccgcgc tcagagcttg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page