(data stored in ACNUC7421 zone)

EMBL: CP001854.PE82

CP001854.PE82        Location/Qualifiers
FT   CDS_pept        complement(76066..76731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0082"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   ank:AnaeK_1303 SNARE associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48518"
FT                   /db_xref="GOA:D3F435"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D3F435"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADB48518.1"
FT                   /translation="MLVLASITEPLVNMATDVVGSLGLAGVFVLMVLESACIPIPSEAT
FT                   MLFAGFNVAQGEYSLLLVTLVGASANLVGSWIAYGVGYFGRLELLEKHGRKLHVSPRSL
FT                   AQADRWFEKHGSAAVLVTRMLPIVRTFISLPAGVSRMPFIRFSVLTFIGCLPWVFMLAF
FT                   IGREARDNWTAWKDSLHYVDYAVAVAIVAVAVYYGLRWRRNRNAPPVADEQATTDAAL"
     gtgctggtcc tcgcctcgat cacggagccc ctcgtgaaca tggcgaccga cgtggtcggc        60
     tctctcggcc tcgccggcgt cttcgtcctg atggtgctcg aaagcgcctg cattccgatc       120
     ccgtcggaag cgacgatgct gttcgccggc ttcaacgtcg cgcagggcga gtactcgctg       180
     ctgctggtga cgctcgtcgg cgcgagcgcg aacctcgtcg gctcgtggat cgcctacggg       240
     gtgggctact tcggccgatt ggagctgctg gagaagcacg gcagaaagct gcacgtctcc       300
     ccgagatcgc tggcgcaggc cgaccgctgg ttcgagaagc acggttccgc cgcggtgctc       360
     gtgacgcgga tgctgccgat cgtccgcacc ttcatctcgc tgcccgccgg cgtctcgcgg       420
     atgccgttca tccgcttctc ggtgctgacg ttcatcggct gcctgccgtg ggtcttcatg       480
     ctcgcgttca tcggccgcga ggcacgcgac aactggactg catggaagga cagcctccac       540
     tacgtcgact acgcggtcgc cgtcgcgatc gtcgccgtcg ccgtctacta cgggctgcgc       600
     tggcgccgca accgcaacgc cccgcccgtc gccgacgagc aggcgaccac cgacgccgcg       660
     ctttga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page