(data stored in ACNUC7421 zone)

EMBL: CP001854.PE83

CP001854.PE83        Location/Qualifiers
FT   CDS_pept        complement(76796..78388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48519"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:D3F436"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48519.1"
FT                   /translation="MRRIILAAFAVLLLHAAPSMAAECRNLALVANGGVASASSEYSGW
FT                   PATALNNGTRETSIDRHWSDGTRFIWPDWAAIEWSSPTRLDQIVVRGLVFTPNKTVAER
FT                   TLDRTRVQYWDDATSTWVDIVGRSGQDNPILAWTGPTHAEDGAEIKQFDFASITTTRIR
FT                   VQIEEGPTVLTGGYSSLDEIEAYDRGGCDPPASQCSNRGLDGIASASSTHSSGLYPVTG
FT                   VNNGQVESGATKGYWNDDTNGVWPDWVQVAWAQPLTINRVVARIPLAQAGFPTGEITLR
FT                   RTRIQYWDATTSTWVDVVGRSGQSNPILDWTGPIGRADGTETRMFHIAPVTTTKIRAVI
FT                   EDGSTDGWSWLDELEAYAADCATPSNENLALGTNAGTAIASSEYSSLASIAKLNDGRRQ
FT                   THLGRTYWMDGTGFSWPDWAGIKWSSPRSLNRIVLRGPALYSSYPTDRRTLGRTRVQYW
FT                   SDDSSTWVDVVGRSGQDNPILNWVMPPDMTDGSEIRQFDFPTVATRRIRALIEEGGTHG
FT                   WSFMEEIEAYWMS"
     atgcgccgga tcatcctggc cgccttcgcg gtgctgcttt tgcacgccgc accgagcatg        60
     gcggccgaat gcagaaacct tgcgctggtc gcgaatggcg gggttgcgag tgcctcgtcc       120
     gagtacagcg gctggcctgc gaccgcgctc aacaacggga cacgtgagac ctccatcgac       180
     cgccactgga gcgacggcac gcgtttcatc tggccggact gggccgcgat cgagtggagc       240
     tcaccgacga gactcgacca gatcgtggtc cgcggcctgg tcttcacccc gaacaagacg       300
     gtcgcagaac gcacactcga cagaacgcgg gtgcagtact gggacgacgc cacgtcgacg       360
     tgggtcgaca tcgtcgggag aagcggtcag gacaacccga tccttgcctg gaccggcccg       420
     acgcatgctg aagacggagc ggagatcaag cagttcgact tcgcgtcgat caccaccacg       480
     agaatccgcg tgcagatcga agagggtccg acggtcctga ccggtggcta ctcgtctctc       540
     gacgagatcg aggcctacga tcgcggtggc tgcgacccgc cggcgtctca atgctcgaac       600
     agaggactgg acgggatcgc ctccgcttca tccacacatt cgagcggcct gtaccccgtc       660
     accggcgtga acaacggcca ggtcgagtcg ggagccacga agggctactg gaacgacgac       720
     accaacggcg tgtggcccga ctgggtccag gtcgcctggg cgcagccact gacgatcaac       780
     agagtcgtgg cgcgcatccc gctggcccag gccgggttcc cgaccggtga gatcacgctc       840
     agaagaaccc gcatccagta ctgggacgca acgacctcga catgggtcga cgtcgtcggc       900
     agaagcggcc agagcaaccc gatcctcgac tggaccggcc cgatcggcag agccgacggc       960
     accgagactc gcatgtttca catcgctccc gtcacgacga ccaagatccg cgcggtcatc      1020
     gaggacggct ccaccgacgg ctggtcctgg ctcgacgagc tcgaagcgta tgcggccgac      1080
     tgcgctacgc ccagcaacga gaacctcgcg ctcggcacca atgcggggac agctatcgca      1140
     tcgtcggagt acagcagcct cgcgtccatc gccaagctga acgacgggag acgtcagacc      1200
     cacctcggcc gtacctactg gatggacggc accgggttca gctggccgga ctgggccgga      1260
     atcaagtgga gctcgccgag atcgctcaac cggatcgtcc tccgcggccc cgcgttgtat      1320
     tcgagctatc ccacagaccg acgcacgctc gggagaacgc gggtccagta ctggagcgac      1380
     gacagctcca cgtgggtcga cgtcgtcggg agaagcgggc aggacaaccc gatcctcaac      1440
     tgggtgatgc cgcctgacat gaccgacgga agtgagatcc ggcagttcga cttccccacg      1500
     gtcgccacac ggagaatccg cgcgctgatc gaagagggcg ggacccacgg ctggtccttc      1560
     atggaagaga tcgaggcgta ctggatgtca tga                                   1593
//

If you have problems or comments...

PBIL Back to PBIL home page