(data stored in ACNUC7421 zone)

EMBL: CP001854.PE84

CP001854.PE84        Location/Qualifiers
FT   CDS_pept        78557..79387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0084"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: oan:Oant_3013
FT                   2,5-didehydrogluconate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48520"
FT                   /db_xref="GOA:D3F437"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D3F437"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADB48520.1"
FT                   /translation="MTKIPTLTLNDGTEIPQLGFGVFQVPPQETAQAVAQALEAGYRHI
FT                   DTAAAYRNEEGVGEAVAASGIPREALFVTTKLWNADQGYDEALRAFDASARRLRLDVVD
FT                   LYLIHWPTPARDRYVPSWRAFERLQADGRVRSIGVSNFQPAHLRRLFDEGEVVPAINQV
FT                   ELHPYLQQPELRAFHAEHEIATEAWSPLAQGAVLDDPAIVAIAQAHGKTPAQVVLRWHL
FT                   QLGNVVIPKSVTPARIAENLDVFDFALSDEQLAAIAALDRGERTGPDPDTMEIA"
     atgacgaaga tccccacgct cacgctcaac gacggcaccg agatcccgca gctcggcttc        60
     ggcgtcttcc aggtcccgcc gcaggagacg gcgcaggcgg tcgcgcaggc gctcgaagcc       120
     ggctaccgcc acatcgatac ggccgccgcg tatcgcaacg aggagggcgt cggcgaggcg       180
     gtcgcagcct ccggcatccc gcgcgaggcg ctgttcgtca cgacgaagct gtggaacgcc       240
     gaccagggct acgacgaggc gctgcgggcc ttcgacgcga gcgcgagacg gctccgcctc       300
     gacgtcgtcg acctctacct gatccactgg ccgacgccgg cgcgcgaccg ctacgtcccg       360
     agctggagag cgttcgaacg tctgcaggcc gacggccgcg tgcgctcgat cggcgtctcg       420
     aacttccagc ccgcgcacct gcgccgcctc ttcgacgagg gcgaggtcgt ccccgcgatc       480
     aaccaggtcg agctgcatcc gtacctccag cagcccgagc tgcgcgcctt ccacgccgag       540
     cacgagatcg cgaccgaggc gtggagcccg ctcgcgcagg gcgcggtcct cgacgacccc       600
     gcgatcgtcg cgatcgccca ggcacacggg aagacgcccg cgcaggtcgt gctgcgctgg       660
     cacctccagc tcggcaacgt cgtgatcccg aagtcggtca cgcccgcccg catcgccgag       720
     aacctcgacg tcttcgactt cgcgctgagc gacgagcagc tggccgcgat cgcggcgctg       780
     gaccgcggcg agcggaccgg cccggacccc gacacgatgg agatcgcctg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page