(data stored in ACNUC7421 zone)

EMBL: CP001854.PE85

CP001854.PE85        Location/Qualifiers
FT   CDS_pept        79433..80461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0085"
FT                   /product="protein of unknown function DUF354"
FT                   /note="PFAM: protein of unknown function DUF354; KEGG:
FT                   lch:Lcho_1392 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48521"
FT                   /db_xref="InterPro:IPR007152"
FT                   /db_xref="UniProtKB/TrEMBL:D3F438"
FT                   /inference="protein motif:PFAM:PF04007"
FT                   /protein_id="ADB48521.1"
FT                   /translation="MRVWIDLTNSPHVVVMRPVIELLRADGHEVHVTARDFAQTLQLCE
FT                   RFGIDHTAIGHHRGGKLSAKGLGLAQRSGALVRWARRRGGRAGFDLALGHGSNDVTVAA
FT                   ALLRIPCSTTFDYEWATVQHNVNCRLAQAVVVPDAIPPERFARYGAVGKLQRYPGLKEE
FT                   YYLADFEPDPAILGELGLDPAEPIVVVRTPPSVSLYHRFEHDTFGAVLERLREQGTQAV
FT                   VLPRTPEQREQLREVGGFILPERAIDAQSLIAFADLMVSAGGTMNREAVALGTPVFTSF
FT                   EGRLGAVDERLIGEGRLRRLTDPDEVVVVKRPGAADGSAPDRIRRDPRDFLRLLAAPVG
FT                   GL"
     atgcgcgtct ggatcgacct caccaactcg ccgcacgtcg tcgtcatgcg gcccgtgatc        60
     gagctgctgc gcgctgacgg ccacgaggtc cacgtgaccg cgcgcgactt cgcgcagacg       120
     ctgcagctgt gcgagcgctt cgggatcgac cacaccgcga tcggccacca ccgcggcggg       180
     aagctgtccg ccaagggcct cgggctcgcg cagcgctccg gcgcgctcgt ccgctgggcg       240
     cgcagacgcg gcggccgcgc cggcttcgac ctcgcgctcg gccacggctc caacgacgtg       300
     accgtcgccg ccgcgctgct gcggatcccc tgctcgacga cgttcgacta cgagtgggcg       360
     accgtccagc acaacgtcaa ctgccgcctt gcgcaggcgg tcgtcgtccc ggacgcgatc       420
     ccgccggagc gcttcgcgcg ctacggcgcc gtcggcaagc tgcagcgcta cccgggcctg       480
     aaggaggagt actacctcgc cgacttcgag cccgacccgg cgatcctcgg cgagctcggg       540
     ctcgaccccg ccgagccgat cgtcgtcgtc cgcacgccgc cgtcggtctc gctctaccac       600
     cgcttcgagc acgacacctt cggcgccgtg ctggagcggc tgcgcgagca ggggacgcag       660
     gcagtcgtgc tgccgcgtac gcccgagcag cgcgagcagc tgcgcgaggt cggcggcttc       720
     atcctgcccg agcgcgcgat cgacgcgcag tcgctgatcg ccttcgccga cctgatggtc       780
     tccgccggcg gcacgatgaa ccgcgaggcg gtcgcgctcg gcacccccgt cttcaccagc       840
     ttcgagggca gactcggcgc ggtcgacgag cgcctgatcg gcgagggccg tctgcgccgc       900
     ctgaccgacc ccgacgaggt cgtcgtcgtc aagcgcccag gcgccgccga cggctccgcg       960
     ccggaccgga tccggcgcga tccgcgcgac ttcctgcgcc tgctcgccgc ccccgtcggc      1020
     gggctctga                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page