(data stored in ACNUC7421 zone)

EMBL: CP001854.PE86

CP001854.PE86        Location/Qualifiers
FT   CDS_pept        80544..82481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0086"
FT                   /product="polysaccharide biosynthesis protein CapD"
FT                   /note="PFAM: polysaccharide biosynthesis protein CapD; Male
FT                   sterility domain; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; short-chain
FT                   dehydrogenase/reductase SDR; dTDP-4-dehydrorhamnose
FT                   reductase; NAD-dependent epimerase/dehydratase; KEGG:
FT                   sfu:Sfum_3360 polysaccharide biosynthesis protein CapD"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48522"
FT                   /db_xref="GOA:D3F439"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3F439"
FT                   /inference="protein motif:PFAM:PF02719"
FT                   /protein_id="ADB48522.1"
FT                   /translation="MRRWYRSGAIPVHRHSLIQLVVDGALVALAYVLAFQLRFDSGIPR
FT                   RYELLRDDTIWWIVPVCLVVFVLFGLYQRLWTYVGQRDYEAVVKAVLVSAVLVVGAIAL
FT                   IHPVQVETHNGVSVAVGMPTGVAAMWLLLMGVSMAAVRFVVHLAFEGRKRGLKVVKGAR
FT                   DVLVIGGGDGGRLLVRELVRNPTLRLRPVGFLDDDPRKRGMKDEHGLKVLGTTSDADLA
FT                   RVLDNAEPHEVIIAIPSAPGTLRARVVRACRDRGIPVRTLPTVFELLQSESGGMQVMRQ
FT                   LRELSIEDILGREPVRMELERVGAYLTGQVVLVTGAGGSIGSELCRQIARVNPRRMVLV
FT                   DHAEDNLFEILRELEDERHVRTAIPVLADCKEEERMREVLTEHRPAVVFHAAAYKHVGM
FT                   MEQNPVEAVRNNALATRLVARIAGEAGVRTFVLVSTDKAVKPATVMGASKALAEWAVEA
FT                   AATRHPGTRYATVRFGNVLGSSGSVVPIFRRQIAAGGPVTITDPRMQRWFMTIPEAVQL
FT                   IIRSGSLSDRSGDVFVLEMGEPVKIVDLARDMIRLSGLEPEQDIAIEVIGPRPGEKFHE
FT                   ELFNPYERPQPTPAEKILRAERARLDQAWVEGTFGEINLLVLEGDAAGLAAKVAELAAM
FT                   RTAPGPQVPS"
     atgcgccggt ggtatcgctc cggagcgatc ccggtccacc gccactcgct gatccagctc        60
     gtagtggacg gtgcgctggt cgccctcgcc tacgtgctcg ccttccagct gcggttcgac       120
     agcggcatcc cgcgtcgcta cgagctgctg cgcgacgaca cgatctggtg gatcgtcccc       180
     gtctgtctcg tcgtcttcgt cctcttcggc ctctaccagc ggctgtggac ctacgtcggc       240
     cagcgcgact acgaggcggt cgtcaaggcc gtgctcgtct cggcggtgct cgtcgtcggc       300
     gcgatcgcgc tgatccaccc ggtccaggtc gagacccaca acggcgtctc ggtcgcggtc       360
     ggcatgccga ccggcgtcgc ggcgatgtgg ctgctgctga tgggcgtctc gatggcggcg       420
     gtccgcttcg tcgtccacct cgcgttcgaa ggccgcaagc gcggcctgaa ggtcgtcaag       480
     ggcgcgcgcg acgtgctcgt gatcggcggc ggcgacggcg gccggctgct cgtccgcgag       540
     ctggtccgta acccgaccct gcggctgcgg ccggtcggct tcctcgacga cgacccgcgc       600
     aagcgcggca tgaaggacga gcacgggctg aaggtgctcg gcacgacctc cgacgccgac       660
     ctcgcgcgcg tgctcgacaa cgccgagccg cacgaggtga tcatcgcgat cccgtcggcc       720
     cccggcacgc tgcgcgcccg cgtcgtgcgt gcctgccgcg accgcggcat ccccgtccgc       780
     acgctgccga ccgtcttcga gctgctgcag agcgagtccg gcggcatgca ggtgatgcgc       840
     cagctgcgcg agctgtcgat cgaggacatc ctcggccgcg agccggtgcg gatggagctg       900
     gagcgggtcg gcgcctacct gaccggccag gtcgtgctcg tgaccggcgc cggtggctcg       960
     atcggcagcg agctgtgccg ccagatcgcg cgcgtcaacc cgcgccggat ggtgctcgtc      1020
     gaccacgccg aggacaacct cttcgagatc ctgcgcgagc tggaggacga gcgccacgtc      1080
     cgcaccgcga tccccgtgct ggcggactgc aaggaggagg agcggatgcg cgaggtgctg      1140
     accgagcacc gccccgccgt cgtcttccac gccgccgcgt acaagcacgt cgggatgatg      1200
     gagcagaacc ccgtcgaggc tgtccgcaac aacgcgctcg cgacccggct cgtcgcccgc      1260
     atcgccggcg aggccggcgt cagaaccttc gtcctcgtct cgaccgacaa ggccgtcaag      1320
     cccgcgaccg tgatgggcgc ctcgaaggcg ctcgcggagt gggcggtcga ggcggccgcg      1380
     acgcggcatc ccggcacccg ctacgcgacc gtccgcttcg gcaacgtgct cggctcctcc      1440
     ggctcggtcg tgccgatctt ccgccgccag atcgccgcgg gcggcccggt cacgatcacc      1500
     gatccgcgca tgcagcgctg gttcatgacg atcccggagg cggtccagct gatcatccgc      1560
     tccggctcgc tgtcggatcg cagcggcgac gtcttcgtgc tggagatggg cgagccggtc      1620
     aagatcgtcg atctcgcgcg cgacatgatc cggctctccg gcctggagcc cgagcaggac      1680
     atcgctatcg aggtgatcgg cccgcgtccg ggcgagaagt tccacgagga gctgttcaac      1740
     ccgtacgagc ggccgcagcc gacgccggcc gagaagatcc tccgcgccga gcgcgcgcgg      1800
     ctcgaccagg cgtgggtcga ggggacgttc ggcgagatca acctgctggt gctcgaaggc      1860
     gacgccgcag ggctcgccgc gaaggtcgcc gagctcgcgg cgatgcgaac cgctccgggg      1920
     ccccaggtac cctcgtga                                                    1938
//

If you have problems or comments...

PBIL Back to PBIL home page