(data stored in ACNUC7421 zone)

EMBL: CP001854.PE87

CP001854.PE87        Location/Qualifiers
FT   CDS_pept        82549..83961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0087"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48523"
FT                   /db_xref="GOA:D3F440"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:D3F440"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48523.1"
FT                   /translation="MLTYALSVRNFVEDIGAYAGFAAVVALALFALLLFAQARELKRLR
FT                   DWGGQAHDRIGELERSVAAALDLARRAQSQQRSQAQGTVAPAGREAVRGPVARGRAAAG
FT                   AAAAPAAGGPPRQAGAGQRAAVASTSAPVRPQLLPSAPVGVGGPALASATVLIPLPGAP
FT                   GSPGGPPAPVQPQHSGPGGPGPRPVTQPAVAASVAGQRGRAVPAAGAGAPASAGARVRD
FT                   AGAAPPPSGSNGHHDDDISEEYEQLPPRRVPPPPPPRRGAGPSTRPRPGGRPQPAAPLR
FT                   AGAAGGGASRAVPPSDPAPHGRRRLIAMIAGVVALVAVAAVAFVVLTGGDDERRPVRVQ
FT                   APVGNGRAQGRSTRQQTRTTPAPPHDQTTVAVLNGTATGGLASTVMTELTGAGFREGTV
FT                   TNASDPNRSVTVVSFRAGKEREAQEVARTLRLSADAVQEIDAGTEAIACANTTPCTVDV
FT                   VVTVGADRQPTQ"
     atgctgacgt acgcactctc cgtaagaaac ttcgtcgagg acatcggcgc atacgccggc        60
     ttcgcggccg tcgtggcgct ggcgctgttc gcgctgctgc tgttcgccca ggcccgcgag       120
     ctgaagcggc tgcgcgactg gggcggccag gcgcacgacc gcatcggcga gctggagcgc       180
     agcgtcgccg ccgcgctcga cctcgcgcgc cgcgcgcagt cgcagcagcg cagccaggcg       240
     cagggcaccg tcgccccggc cggacgcgag gccgtccgcg gtcccgtcgc gcgcggccgt       300
     gccgccgccg gagccgccgc ggcaccggca gccggcggtc cgccgcgtca ggccggcgct       360
     ggacagcgcg ccgccgtcgc ctcgacctcg gcacccgtgc gtccgcagct gctgccgtcg       420
     gcgccggtcg gcgtcggcgg gcccgcgctg gcctccgcga ccgtcctgat cccgctgccg       480
     ggcgcaccgg gctcccccgg tggtccgccc gcgcccgtcc agccgcagca cagcggtccc       540
     ggcggccccg ggccgcgccc ggtcacgcag cccgccgtcg cggcgtcggt cgccggccag       600
     cgcggccgcg cggtccccgc cgccggcgcg ggcgctcctg cgtccgccgg cgcgcgcgtg       660
     cgcgacgcag gcgccgcacc gccgccgagc ggctccaacg gccaccacga cgatgacatc       720
     tcggaggagt acgagcagct gccgccgcgg cgcgtgcccc cgcccccgcc gccgcgtcgc       780
     ggcgccggtc cgagcacccg cccgcgcccc ggcggccggc cgcagccggc cgcgccgctg       840
     cgcgccggag cagccggcgg cggcgcctcg cgcgccgtgc cgccgtccga tcctgcaccg       900
     cacggtcgtc gccggctgat cgcgatgatc gccggcgtcg tcgcgctggt cgcggtcgcc       960
     gcggtcgcgt tcgtcgtcct caccggcggt gacgacgaga gaagacccgt ccgcgtccag      1020
     gcgcccgtcg gcaacggcag agcccagggc agatcgacca gacagcagac gagaacgacg      1080
     cccgccccgc cgcacgacca gacgaccgtc gcggtcctca acggcaccgc gacgggcggc      1140
     ctcgcgagca cggtcatgac ggagctgacc ggcgcgggct tcagagaggg caccgtcacg      1200
     aacgcgtcgg acccgaatcg ctcggtcacc gtggtctcct tcagagccgg caaggagcgc      1260
     gaggcgcagg aggtcgcgag aacgctgaga ctgtccgccg acgccgtcca ggagatcgac      1320
     gcgggcaccg aggcgatcgc gtgcgcgaac acgacgccat gcacggtcga cgtcgtcgtg      1380
     accgtcggcg ccgatcgcca gccgacgcaa tag                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page