(data stored in ACNUC7421 zone)

EMBL: CP001854.PE88

CP001854.PE88        Location/Qualifiers
FT   CDS_pept        83987..84781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0088"
FT                   /product="Phosphosulfolactate synthase"
FT                   /EC_number="4.4.1.19"
FT                   /note="PFAM: (2R)-phospho-3-sulfolactate synthase ComA;
FT                   KEGG: phosphosulfolactate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48524"
FT                   /db_xref="GOA:D3F441"
FT                   /db_xref="InterPro:IPR003830"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036112"
FT                   /db_xref="UniProtKB/TrEMBL:D3F441"
FT                   /inference="protein motif:PRIAM:4.4.1.19"
FT                   /protein_id="ADB48524.1"
FT                   /translation="MTPPFLDLPQRGGKPRQRGLTHVIDRGLSLAEVDGMLEVAGDAVD
FT                   IVKLGWGTAVVTQNLGVKLARYREHDIPVVLGGTLTELAISQRRVDELVGWLRELGIGH
FT                   VEISDGTITLPHSEKLALIERLAGEFTVLSEVGSKDDTRIMAPYVWVEQIERELEAGAW
FT                   KVIAEARESGTAGIYRADGEVRMGLIDEIAHAIAPERLLFEAPQKEQQVWFVQRFGLDV
FT                   NLGNIAPQDVLSLETLRLGLRSDTVPPAQPDERPAAPERTQR"
     atgacgcctc cgttcctcga cctcccgcag cgcggcggga agccgcggca gcgcggtctc        60
     acgcacgtga tcgacagagg gctgtcgctc gccgaggtcg acggcatgct cgaggtcgcg       120
     ggtgacgcgg tcgacatcgt caagctcggc tgggggaccg ccgtcgtgac gcagaacctc       180
     ggcgtgaagc tcgcgcgcta ccgcgagcac gacatcccgg tcgtgctcgg cggcacgctc       240
     accgagctgg cgatctcgca gcgcagagtc gacgagctgg tcggctggct gcgcgagctg       300
     gggatcggcc acgtcgagat ctccgacggc acgatcacgc tgccgcacag cgagaagctc       360
     gcgctgatcg agcggctcgc gggcgagttc accgtcctct ccgaggtcgg ctccaaggac       420
     gacacgcgga tcatggcgcc gtacgtgtgg gtggagcaga tcgagcgtga gctggaggcc       480
     ggcgcctgga aggtgatcgc cgaggcccgc gagtccggca ctgccggcat ctaccgcgcc       540
     gacggcgagg tgcggatggg gctgatcgac gagatcgcgc acgcgatcgc gccggagcgg       600
     ctgctgttcg aggcaccgca gaaggagcag caggtctggt tcgtgcagcg cttcgggctc       660
     gacgtcaacc tcggcaacat cgcgccgcag gacgtcctgt cgctggagac gctgcgactc       720
     gggctgcgct cggacacggt gccgcccgcg cagccggacg agcgcccggc cgccccggag       780
     cgcacccagc ggtga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page