(data stored in ACNUC7421 zone)

EMBL: CP001854.PE89

CP001854.PE89        Location/Qualifiers
FT   CDS_pept        84778..86577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0089"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: esa:ESA_02272 flagellar basal body rod
FT                   modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48525"
FT                   /db_xref="UniProtKB/TrEMBL:D3F442"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48525.1"
FT                   /translation="MTRAARIVFGLLVLATLGAFVVGQKLKSTPPLIVRPLVDVVFSPV
FT                   ANDPGKDRRAKISFWLVRGDDITVSIVNDEGRIVRTLADGVAVPKKVRKTWWWDGRTED
FT                   GGRAPDGYYRVRVALIHQGRTVELPDVEIALDTKPPKPRVVSVEPEGDSGPAFLPQRGV
FT                   DAVTVAIRGTEGRKARLQVWRTDVTPARIVDEVDIPGRQASAEWDGTVDGRPAPAGTYL
FT                   MGLLVADRAGNRGTFPAQVPPRSGDVPGRAGVTVRYLAAAPSFTPVRAGASTTVFVDAR
FT                   RRRYSWALRRWGDPRVLARGRGRDVRLRVRTPRGQAGLHVLSIATADHRTQVPIVVRAR
FT                   VPRRVLVVLPSLTWEGLNAVDDDGDGMPNTLDGAGRDASARLGRPLAKGMPTSIPAQEG
FT                   ALLRFLDDNLLRYDLTTDAALAAGTGPSLGDYAGAVFAGDSRWITPQLRRALRRRVQDG
FT                   GRIWSLGTDALRRSVRLRDGLLTQPSTPAPTDALGARPVVPLVESPAPVTLTTSLNGPI
FT                   FDQTGGSFAGYDSYETLASVIPEAELSAAAGPDADTNVIASWQLGDGTAIHTGLPQLAS
FT                   KAADDELDAAALVRSIWSVVGAP"
     gtgacgcgcg ccgcacgcat cgtcttcggg ctgctcgtgc tggcgacgct cggcgccttc        60
     gtcgtcggtc agaagctcaa gagcacaccg ccgctgatcg tgcggccgct cgtcgacgtc       120
     gtcttctcgc cggtcgcgaa cgatcccggc aaggatcgcc gcgcgaagat ctcgttctgg       180
     ctcgtccgcg gcgacgacat caccgtctcg atcgtcaacg acgagggccg gatcgtgcgc       240
     acgctcgcgg acggcgtcgc ggtccccaag aaggtccgca agacgtggtg gtgggacggc       300
     cgcaccgagg acggcggacg cgccccggac ggctactaca gagtgcgcgt cgcgctgatc       360
     caccagggcc gcacggtcga gctgcccgac gtcgagatcg cgctcgacac gaagccgccg       420
     aagccgcgcg tcgtctccgt cgagccggag ggcgacagcg ggccggcgtt cctgccgcag       480
     agaggcgtcg acgccgtcac ggtcgcgatc agagggacgg agggccgcaa ggcgcggctg       540
     caggtctggc gcaccgatgt gacgcccgcg cggatcgtcg acgaggtcga catccccggg       600
     cggcaggcga gcgccgagtg ggacggcacg gtcgacggca gaccggcgcc ggccggcacc       660
     tacctgatgg gcctgctggt cgccgatcgc gccggcaacc gcggcacctt ccccgcgcag       720
     gtcccgccga gatcgggcga cgtgcccgga cgggccggcg tgaccgtccg ctacctcgcc       780
     gccgcgccgt cgttcacacc ggtccgcgcc ggcgcctcga cgaccgtctt cgtcgacgcg       840
     cgcagacgca gatacagctg ggcgctgcgg cgctggggcg acccgagagt gctcgcgcgc       900
     ggcagaggcc gcgacgttcg cctgcgcgtc agaacgccgc gcgggcaggc ggggctgcac       960
     gtgctgagca tcgcgacggc cgaccaccgc acgcaggtgc cgatcgtcgt gcgcgcgaga      1020
     gtgccgcggc gggtgctcgt cgtgctgccg tcgctgacgt gggaaggact caacgcggtc      1080
     gacgacgacg gcgacggaat gccgaacacg ctcgacggcg ccggccgcga cgcctccgcc      1140
     cggctcggac gcccgctcgc gaaggggatg cccacgtcga tcccggcgca ggagggcgcg      1200
     ctgctgcgct tcctcgacga caacctgctg cgctacgacc tgacgaccga cgccgcgctc      1260
     gccgccggca ccggtccgtc gctcggcgac tacgccggcg cggtcttcgc cggcgactcg      1320
     cgctggatca cgccgcagct gcgcagagcg ctgcgccgac gcgtgcagga cggcgggcgg      1380
     atctggtcgc tcggaacgga cgcgctgcgc cgcagcgtgc ggctgcgcga cgggctgctg      1440
     acgcagccgt cgacccccgc gccgacggac gcgctcggtg cgcgccctgt cgtgccgctg      1500
     gtcgagtcgc cggcgccggt cacgctcacg acctcgctca acgggccgat cttcgatcag      1560
     acgggcggct cgttcgccgg ctacgacagc tacgagacgc tcgcgtcggt gatccccgag      1620
     gcggagctgt ccgccgccgc cggcccggac gccgacacga acgtgatcgc ctcgtggcag      1680
     ctcggcgacg gcaccgcgat ccacacgggc ctgccgcagc tggcgagcaa ggcggccgac      1740
     gacgagctcg acgccgccgc gctcgtgcgc tcgatctggt cggtcgtcgg cgcgccgtga      1800
//

If you have problems or comments...

PBIL Back to PBIL home page